Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Y7TPD5

Protein Details
Accession A0A4Y7TPD5    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
81-122PLDLRYKKTRAIRRRLTKHESSLKTVKQVKKEKNFPVRKYAVHydrophilic
NLS Segment(s)
PositionSequence
86-115YKKTRAIRRRLTKHESSLKTVKQVKKEKNF
Subcellular Location(s) nucl 19.5, cyto_nucl 12.833, mito_nucl 12.166, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR018254  Ribosomal_L29_CS  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
PROSITE View protein in PROSITE  
PS00579  RIBOSOMAL_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MPGKVKAYELQSKSKNDLSKQLVDLKHELLTLRVQKIAGGSASKLTKINTVRKSVARVLTVMNQKARQNLREYYKNKKFLPLDLRYKKTRAIRRRLTKHESSLKTVKQVKKEKNFPVRKYAVRA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.55
3 0.48
4 0.53
5 0.5
6 0.49
7 0.48
8 0.51
9 0.47
10 0.45
11 0.45
12 0.37
13 0.32
14 0.28
15 0.24
16 0.18
17 0.22
18 0.23
19 0.22
20 0.21
21 0.2
22 0.2
23 0.2
24 0.2
25 0.15
26 0.11
27 0.1
28 0.13
29 0.14
30 0.14
31 0.15
32 0.14
33 0.19
34 0.23
35 0.32
36 0.32
37 0.36
38 0.39
39 0.39
40 0.43
41 0.41
42 0.39
43 0.31
44 0.27
45 0.23
46 0.26
47 0.28
48 0.26
49 0.24
50 0.24
51 0.24
52 0.3
53 0.31
54 0.28
55 0.28
56 0.31
57 0.35
58 0.42
59 0.44
60 0.49
61 0.55
62 0.59
63 0.56
64 0.58
65 0.53
66 0.51
67 0.57
68 0.55
69 0.57
70 0.58
71 0.63
72 0.58
73 0.59
74 0.58
75 0.58
76 0.6
77 0.59
78 0.62
79 0.67
80 0.74
81 0.82
82 0.85
83 0.84
84 0.81
85 0.8
86 0.8
87 0.73
88 0.7
89 0.68
90 0.62
91 0.62
92 0.64
93 0.61
94 0.61
95 0.67
96 0.7
97 0.72
98 0.79
99 0.8
100 0.83
101 0.87
102 0.82
103 0.82
104 0.8