Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y7TNB3

Protein Details
Accession A0A4Y7TNB3   
Localization Confidence Low
Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
94-129LATKVDKASRKLRKERKNRAKKFRGTKKIKGSEATKBasic
NLS Segment(s)
PositionSequence
97-131KVDKASRKLRKERKNRAKKFRGTKKIKGSEATKKK
Subcellular Location(s) mito 23, nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
IPR018098  Ribosomal_S24e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
PROSITE View protein in PROSITE  
PS00529  RIBOSOMAL_S24E  
Amino Acid Sequences APVTLRTRKFITNRLLARRQFVLDVLHPGRANVSKEDLSEKLAAIYKTDKARVVTFGLRTQFGGGRSTGFALIYDDEASQKKFEPRYRLVRSGLATKVDKASRKLRKERKNRAKKFRGTKKIKGSEATKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.7
3 0.64
4 0.63
5 0.57
6 0.51
7 0.42
8 0.36
9 0.31
10 0.24
11 0.3
12 0.27
13 0.27
14 0.26
15 0.24
16 0.26
17 0.26
18 0.26
19 0.2
20 0.23
21 0.21
22 0.22
23 0.25
24 0.23
25 0.22
26 0.2
27 0.18
28 0.16
29 0.18
30 0.17
31 0.15
32 0.17
33 0.18
34 0.2
35 0.22
36 0.22
37 0.2
38 0.22
39 0.22
40 0.23
41 0.22
42 0.21
43 0.23
44 0.22
45 0.2
46 0.19
47 0.18
48 0.17
49 0.15
50 0.14
51 0.11
52 0.1
53 0.1
54 0.11
55 0.1
56 0.07
57 0.07
58 0.06
59 0.06
60 0.06
61 0.07
62 0.06
63 0.08
64 0.09
65 0.09
66 0.09
67 0.11
68 0.15
69 0.21
70 0.26
71 0.32
72 0.38
73 0.48
74 0.54
75 0.57
76 0.55
77 0.53
78 0.5
79 0.48
80 0.43
81 0.38
82 0.32
83 0.29
84 0.32
85 0.32
86 0.34
87 0.34
88 0.42
89 0.46
90 0.55
91 0.64
92 0.69
93 0.75
94 0.83
95 0.89
96 0.9
97 0.92
98 0.93
99 0.94
100 0.94
101 0.93
102 0.93
103 0.93
104 0.93
105 0.91
106 0.9
107 0.9
108 0.89
109 0.84
110 0.8
111 0.77