Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y7SZE9

Protein Details
Accession A0A4Y7SZE9    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MGQNRSPLRTPKKRRVARGATGGFHydrophilic
NLS Segment(s)
PositionSequence
12-15KKRR
Subcellular Location(s) mito 24, cyto 2
Family & Domain DBs
Amino Acid Sequences MGQNRSPLRTPKKRRVARGATGGFAQTLYCSIGGIARAFELRLVRLLNIIWRVSTRAIVADNVEASDWETA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.86
3 0.84
4 0.81
5 0.81
6 0.72
7 0.62
8 0.54
9 0.45
10 0.35
11 0.26
12 0.18
13 0.08
14 0.07
15 0.06
16 0.05
17 0.05
18 0.05
19 0.05
20 0.06
21 0.06
22 0.06
23 0.05
24 0.05
25 0.05
26 0.07
27 0.07
28 0.06
29 0.08
30 0.08
31 0.08
32 0.09
33 0.09
34 0.12
35 0.14
36 0.14
37 0.12
38 0.13
39 0.15
40 0.15
41 0.16
42 0.13
43 0.12
44 0.13
45 0.14
46 0.15
47 0.14
48 0.14
49 0.13
50 0.13
51 0.11