Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y7T779

Protein Details
Accession A0A4Y7T779   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MERTRTRTRPTPRRRVPVQRHVSLSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 26
Family & Domain DBs
InterPro View protein in InterPro  
IPR000277  Cys/Met-Metab_PyrdxlP-dep_enz  
IPR015424  PyrdxlP-dep_Trfase  
IPR015422  PyrdxlP-dep_Trfase_small  
Gene Ontology GO:0003824  F:catalytic activity  
GO:0030170  F:pyridoxal phosphate binding  
GO:0019346  P:transsulfuration  
Pfam View protein in Pfam  
PF01053  Cys_Met_Meta_PP  
Amino Acid Sequences MERTRTRTRPTPRRRVPVQRHVSLSLPSCAFAVAFLQRPRLFYLAEHPRSMTHGGILRPNVAIGIDDRLVRLSVVIEEGEDLVEDVVQALDCVSGLGP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.9
3 0.89
4 0.89
5 0.87
6 0.81
7 0.76
8 0.69
9 0.61
10 0.53
11 0.45
12 0.38
13 0.29
14 0.24
15 0.19
16 0.17
17 0.14
18 0.11
19 0.1
20 0.09
21 0.13
22 0.14
23 0.19
24 0.2
25 0.21
26 0.23
27 0.22
28 0.21
29 0.16
30 0.24
31 0.28
32 0.3
33 0.29
34 0.27
35 0.26
36 0.28
37 0.29
38 0.2
39 0.12
40 0.14
41 0.14
42 0.17
43 0.17
44 0.16
45 0.14
46 0.14
47 0.12
48 0.09
49 0.08
50 0.06
51 0.08
52 0.08
53 0.08
54 0.09
55 0.09
56 0.1
57 0.09
58 0.09
59 0.07
60 0.06
61 0.07
62 0.07
63 0.06
64 0.06
65 0.07
66 0.06
67 0.06
68 0.05
69 0.04
70 0.04
71 0.04
72 0.04
73 0.04
74 0.04
75 0.04
76 0.04
77 0.04
78 0.04