Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y7T965

Protein Details
Accession A0A4Y7T965   
Localization Confidence Medium
Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
89-109RAKEEKGKKRDVSPDKKRRRRBasic
NLS Segment(s)
PositionSequence
85-109KEKERAKEEKGKKRDVSPDKKRRRR
Subcellular Location(s) mito 13, nucl 12
Family & Domain DBs
Pfam View protein in Pfam  
PF13917  zf-CCHC_3  
Amino Acid Sequences MSKFAPHTRSANQAKATASTTCQKCLGKGHFTFECKGARPYISRPSRTQQLANPKLAAKLKPSVEVPEEFLKKPAGTADQILAAKEKERAKEEKGKKRDVSPDKKRRRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.42
3 0.4
4 0.32
5 0.29
6 0.31
7 0.3
8 0.29
9 0.33
10 0.31
11 0.3
12 0.37
13 0.4
14 0.39
15 0.39
16 0.42
17 0.42
18 0.44
19 0.43
20 0.39
21 0.36
22 0.3
23 0.3
24 0.26
25 0.23
26 0.24
27 0.27
28 0.33
29 0.37
30 0.39
31 0.41
32 0.44
33 0.48
34 0.48
35 0.46
36 0.4
37 0.45
38 0.45
39 0.43
40 0.39
41 0.33
42 0.34
43 0.34
44 0.3
45 0.22
46 0.22
47 0.22
48 0.23
49 0.23
50 0.22
51 0.22
52 0.22
53 0.22
54 0.24
55 0.26
56 0.24
57 0.24
58 0.23
59 0.21
60 0.2
61 0.19
62 0.15
63 0.14
64 0.15
65 0.14
66 0.17
67 0.18
68 0.18
69 0.17
70 0.15
71 0.15
72 0.2
73 0.23
74 0.23
75 0.27
76 0.32
77 0.37
78 0.47
79 0.57
80 0.61
81 0.66
82 0.71
83 0.7
84 0.74
85 0.77
86 0.78
87 0.78
88 0.79
89 0.82