Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y7T6L1

Protein Details
Accession A0A4Y7T6L1    Localization Confidence Low Confidence Score 8.5
NoLS Segment(s)
PositionSequenceProtein Nature
10-37PTTLHCKGKTCKKHTPHKVTQYKKGKDSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, mito_nucl 11.5, mito 8.5, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences MVNVPKYVEPTTLHCKGKTCKKHTPHKVTQYKKGKDSLAAQGKRRYDRKQSGYGGQTKPVFHKKAKTTKKVVLRLECTVCKYKMQISLKRCKHFELGGEKKTKGAALTFTSRVPG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.45
3 0.5
4 0.58
5 0.62
6 0.62
7 0.65
8 0.7
9 0.8
10 0.84
11 0.86
12 0.86
13 0.86
14 0.88
15 0.85
16 0.86
17 0.86
18 0.81
19 0.75
20 0.7
21 0.6
22 0.54
23 0.51
24 0.5
25 0.5
26 0.48
27 0.48
28 0.49
29 0.52
30 0.55
31 0.57
32 0.52
33 0.52
34 0.57
35 0.58
36 0.61
37 0.59
38 0.58
39 0.57
40 0.59
41 0.5
42 0.45
43 0.41
44 0.34
45 0.35
46 0.36
47 0.35
48 0.3
49 0.36
50 0.4
51 0.49
52 0.57
53 0.6
54 0.6
55 0.63
56 0.7
57 0.71
58 0.69
59 0.66
60 0.61
61 0.58
62 0.56
63 0.51
64 0.46
65 0.43
66 0.37
67 0.32
68 0.29
69 0.29
70 0.33
71 0.4
72 0.43
73 0.46
74 0.56
75 0.63
76 0.68
77 0.65
78 0.6
79 0.56
80 0.52
81 0.51
82 0.51
83 0.51
84 0.52
85 0.56
86 0.52
87 0.49
88 0.47
89 0.41
90 0.32
91 0.25
92 0.22
93 0.23
94 0.29
95 0.29