Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y7TYU6

Protein Details
Accession A0A4Y7TYU6   
Localization Confidence Low
Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
54-73AKDRRIKRTPPKETNTPERNBasic
NLS Segment(s)
Subcellular Location(s) nucl 10, mito 9, cyto 6
Family & Domain DBs
Amino Acid Sequences MTMETVQQKKQMYAKQLADHTFRQYQLAWNEKELKTGGNGRGRESGDPSSSEVAKDRRIKRTPPKETNTPERNQHSVRNRGTGLLLGPGRA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.51
3 0.54
4 0.54
5 0.51
6 0.47
7 0.46
8 0.41
9 0.36
10 0.32
11 0.28
12 0.29
13 0.31
14 0.36
15 0.32
16 0.32
17 0.38
18 0.37
19 0.38
20 0.32
21 0.26
22 0.21
23 0.26
24 0.28
25 0.27
26 0.28
27 0.28
28 0.32
29 0.32
30 0.3
31 0.28
32 0.24
33 0.19
34 0.19
35 0.19
36 0.16
37 0.15
38 0.15
39 0.15
40 0.15
41 0.22
42 0.29
43 0.33
44 0.41
45 0.46
46 0.54
47 0.61
48 0.7
49 0.74
50 0.75
51 0.76
52 0.76
53 0.79
54 0.81
55 0.77
56 0.71
57 0.69
58 0.65
59 0.65
60 0.58
61 0.6
62 0.59
63 0.61
64 0.6
65 0.58
66 0.53
67 0.48
68 0.46
69 0.38
70 0.3
71 0.28