Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A5DNE3

Protein Details
Accession A5DNE3    Localization Confidence Medium Confidence Score 14
NoLS Segment(s)
PositionSequenceProtein Nature
350-375KKPDSIILKYAKKKRMGKNRFVVCPRHydrophilic
NLS Segment(s)
PositionSequence
361-365KKKRM
Subcellular Location(s) nucl 17, mito 3.5, cyto_mito 3.5, cyto 2.5, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR019128  Dcc1  
Gene Ontology GO:0031390  C:Ctf18 RFC-like complex  
GO:0006260  P:DNA replication  
GO:0007064  P:mitotic sister chromatid cohesion  
KEGG pgu:PGUG_04794  -  
Pfam View protein in Pfam  
PF09724  Dcc1  
Amino Acid Sequences MGKITYHAFNQLSSESGHTYKLIQLPPDVLSHIEHGSEPLQLKSSPGESTDLTLCTNNKSWRIRQMNHSNTVFLLNDLNINCMGQKIQHDSNKENEPNKTIETSNMLMGFASNSFEYELTSTPGSINADRLPIYDGNEFKPTGYSEKDLLLDSPVSKNQFYKIWYDLCGCEVHGSAVILSRKFVTDFLSVLIPVIISIDGAYSSEDYNLEVKQISELLAKENELYTPEICWSIFHKFGDVHEGKFKLKNIVITRWFGIQALSRQTQPMDCKQFLLLWKGSLPHFYNVPLDLEQLKGYYFKPTSTSVQYLEPSSLSHANAGSRIKELFSVSKEWDLDDFIPFIQEFIPTGKKPDSIILKYAKKKRMGKNRFVVCPR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.19
3 0.19
4 0.2
5 0.18
6 0.18
7 0.22
8 0.28
9 0.28
10 0.27
11 0.27
12 0.29
13 0.3
14 0.29
15 0.25
16 0.2
17 0.18
18 0.19
19 0.18
20 0.16
21 0.15
22 0.15
23 0.15
24 0.18
25 0.18
26 0.16
27 0.18
28 0.17
29 0.18
30 0.19
31 0.21
32 0.17
33 0.17
34 0.19
35 0.17
36 0.2
37 0.21
38 0.19
39 0.19
40 0.21
41 0.2
42 0.21
43 0.27
44 0.29
45 0.35
46 0.4
47 0.44
48 0.51
49 0.6
50 0.61
51 0.65
52 0.71
53 0.71
54 0.73
55 0.69
56 0.59
57 0.5
58 0.48
59 0.37
60 0.27
61 0.21
62 0.13
63 0.15
64 0.14
65 0.15
66 0.12
67 0.12
68 0.12
69 0.11
70 0.11
71 0.09
72 0.13
73 0.17
74 0.25
75 0.29
76 0.34
77 0.36
78 0.42
79 0.48
80 0.51
81 0.49
82 0.45
83 0.43
84 0.42
85 0.41
86 0.37
87 0.29
88 0.25
89 0.25
90 0.23
91 0.22
92 0.2
93 0.17
94 0.14
95 0.14
96 0.13
97 0.08
98 0.08
99 0.06
100 0.06
101 0.07
102 0.07
103 0.08
104 0.08
105 0.09
106 0.1
107 0.1
108 0.1
109 0.09
110 0.11
111 0.12
112 0.11
113 0.13
114 0.12
115 0.13
116 0.13
117 0.13
118 0.15
119 0.13
120 0.16
121 0.18
122 0.18
123 0.19
124 0.21
125 0.21
126 0.18
127 0.18
128 0.17
129 0.16
130 0.17
131 0.16
132 0.15
133 0.17
134 0.18
135 0.16
136 0.15
137 0.14
138 0.12
139 0.11
140 0.12
141 0.13
142 0.14
143 0.14
144 0.15
145 0.15
146 0.17
147 0.18
148 0.19
149 0.2
150 0.2
151 0.21
152 0.22
153 0.2
154 0.19
155 0.17
156 0.14
157 0.12
158 0.1
159 0.09
160 0.07
161 0.07
162 0.06
163 0.09
164 0.11
165 0.1
166 0.1
167 0.1
168 0.1
169 0.1
170 0.11
171 0.1
172 0.1
173 0.1
174 0.11
175 0.1
176 0.1
177 0.09
178 0.09
179 0.05
180 0.04
181 0.04
182 0.03
183 0.03
184 0.03
185 0.03
186 0.03
187 0.03
188 0.04
189 0.04
190 0.04
191 0.05
192 0.05
193 0.06
194 0.07
195 0.07
196 0.07
197 0.07
198 0.07
199 0.07
200 0.07
201 0.07
202 0.08
203 0.08
204 0.1
205 0.1
206 0.1
207 0.11
208 0.1
209 0.1
210 0.09
211 0.11
212 0.08
213 0.09
214 0.09
215 0.09
216 0.09
217 0.1
218 0.11
219 0.13
220 0.16
221 0.15
222 0.17
223 0.16
224 0.17
225 0.26
226 0.24
227 0.23
228 0.25
229 0.27
230 0.27
231 0.29
232 0.3
233 0.26
234 0.27
235 0.32
236 0.31
237 0.37
238 0.38
239 0.37
240 0.37
241 0.33
242 0.31
243 0.24
244 0.22
245 0.17
246 0.18
247 0.21
248 0.21
249 0.2
250 0.21
251 0.22
252 0.25
253 0.26
254 0.31
255 0.33
256 0.32
257 0.32
258 0.32
259 0.35
260 0.33
261 0.35
262 0.27
263 0.21
264 0.22
265 0.23
266 0.23
267 0.25
268 0.25
269 0.21
270 0.21
271 0.21
272 0.22
273 0.21
274 0.23
275 0.18
276 0.17
277 0.16
278 0.16
279 0.14
280 0.13
281 0.12
282 0.12
283 0.12
284 0.17
285 0.17
286 0.17
287 0.2
288 0.24
289 0.28
290 0.32
291 0.34
292 0.29
293 0.32
294 0.33
295 0.31
296 0.28
297 0.23
298 0.18
299 0.2
300 0.2
301 0.17
302 0.17
303 0.17
304 0.17
305 0.21
306 0.23
307 0.2
308 0.19
309 0.19
310 0.18
311 0.19
312 0.21
313 0.22
314 0.22
315 0.25
316 0.26
317 0.3
318 0.3
319 0.29
320 0.27
321 0.25
322 0.23
323 0.21
324 0.2
325 0.15
326 0.16
327 0.15
328 0.14
329 0.11
330 0.1
331 0.1
332 0.14
333 0.2
334 0.19
335 0.24
336 0.26
337 0.28
338 0.29
339 0.35
340 0.4
341 0.37
342 0.44
343 0.48
344 0.55
345 0.63
346 0.7
347 0.71
348 0.71
349 0.77
350 0.8
351 0.83
352 0.84
353 0.85
354 0.86
355 0.87