Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A5DIK1

Protein Details
Accession A5DIK1   
Localization Confidence Medium
Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
43-62SANPVTPKLKRKNQNDDFSMHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20, cyto_nucl 13.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR013627  Pol_alpha_B_N  
Gene Ontology GO:0005634  C:nucleus  
KEGG pgu:PGUG_03102  -  
Pfam View protein in Pfam  
PF08418  Pol_alpha_B_N  
Amino Acid Sequences MQSNLVNTASNATPSLKKIKDFNGRMKPVIRSTNGLTDSSPLSANPVTPKLKRKNQNDDFSMFKTPRMDLASSPGDYATANNTFQNSTAPSSSPTSAKTSGASHTVIETLNPNVEEAAGVNDSEKKAFTLSYNFDPSKYKFRTMSMKLLESADVLDDQIDTMTRLFLETGKGKMSILETPASALNSRCTAAEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.31
3 0.3
4 0.32
5 0.37
6 0.45
7 0.52
8 0.57
9 0.63
10 0.65
11 0.67
12 0.67
13 0.66
14 0.62
15 0.58
16 0.58
17 0.5
18 0.43
19 0.42
20 0.46
21 0.44
22 0.39
23 0.32
24 0.28
25 0.26
26 0.23
27 0.2
28 0.12
29 0.13
30 0.13
31 0.14
32 0.16
33 0.21
34 0.25
35 0.29
36 0.39
37 0.45
38 0.54
39 0.62
40 0.68
41 0.73
42 0.77
43 0.81
44 0.75
45 0.69
46 0.63
47 0.57
48 0.53
49 0.42
50 0.35
51 0.28
52 0.24
53 0.25
54 0.24
55 0.22
56 0.16
57 0.22
58 0.23
59 0.21
60 0.21
61 0.17
62 0.14
63 0.13
64 0.13
65 0.11
66 0.1
67 0.1
68 0.1
69 0.11
70 0.11
71 0.11
72 0.12
73 0.11
74 0.1
75 0.11
76 0.11
77 0.12
78 0.14
79 0.15
80 0.14
81 0.15
82 0.17
83 0.17
84 0.17
85 0.16
86 0.15
87 0.16
88 0.17
89 0.16
90 0.12
91 0.11
92 0.12
93 0.1
94 0.09
95 0.09
96 0.08
97 0.08
98 0.08
99 0.08
100 0.07
101 0.07
102 0.06
103 0.05
104 0.06
105 0.06
106 0.05
107 0.06
108 0.08
109 0.08
110 0.09
111 0.09
112 0.07
113 0.08
114 0.09
115 0.1
116 0.13
117 0.17
118 0.21
119 0.27
120 0.27
121 0.28
122 0.31
123 0.33
124 0.38
125 0.37
126 0.37
127 0.32
128 0.37
129 0.45
130 0.46
131 0.52
132 0.46
133 0.45
134 0.42
135 0.41
136 0.37
137 0.27
138 0.23
139 0.14
140 0.1
141 0.08
142 0.07
143 0.06
144 0.06
145 0.06
146 0.06
147 0.06
148 0.06
149 0.06
150 0.06
151 0.07
152 0.07
153 0.08
154 0.13
155 0.15
156 0.17
157 0.18
158 0.19
159 0.18
160 0.2
161 0.21
162 0.19
163 0.19
164 0.18
165 0.17
166 0.18
167 0.2
168 0.2
169 0.19
170 0.17
171 0.18
172 0.19
173 0.19