Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y7SUF8

Protein Details
Accession A0A4Y7SUF8   
Localization Confidence Low
Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-33MNKDRGQRRWVRSTERSRKRKGGGDKESKSKRTBasic
NLS Segment(s)
PositionSequence
8-32RRWVRSTERSRKRKGGGDKESKSKR
Subcellular Location(s) mito 17.5, mito_nucl 11.5, cyto 5, nucl 4.5
Family & Domain DBs
Amino Acid Sequences MNKDRGQRRWVRSTERSRKRKGGGDKESKSKRTITNPGFVSTPLPDMFPPVQPTEEKVDIAPQSAPSSPLSHLGVGLEGWVSAVALMRDEATLGHSRWPPLIFGAAENRMARSARKDSKMKVRYESTTA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.83
3 0.85
4 0.83
5 0.85
6 0.82
7 0.8
8 0.8
9 0.8
10 0.79
11 0.81
12 0.78
13 0.8
14 0.81
15 0.75
16 0.67
17 0.62
18 0.57
19 0.55
20 0.59
21 0.53
22 0.53
23 0.51
24 0.5
25 0.45
26 0.39
27 0.33
28 0.23
29 0.22
30 0.14
31 0.13
32 0.11
33 0.15
34 0.16
35 0.16
36 0.17
37 0.16
38 0.17
39 0.16
40 0.19
41 0.2
42 0.2
43 0.18
44 0.16
45 0.18
46 0.17
47 0.17
48 0.15
49 0.11
50 0.11
51 0.11
52 0.12
53 0.1
54 0.11
55 0.11
56 0.13
57 0.13
58 0.12
59 0.12
60 0.1
61 0.1
62 0.08
63 0.07
64 0.04
65 0.03
66 0.03
67 0.03
68 0.03
69 0.03
70 0.03
71 0.03
72 0.04
73 0.04
74 0.04
75 0.04
76 0.05
77 0.05
78 0.07
79 0.1
80 0.11
81 0.16
82 0.17
83 0.18
84 0.21
85 0.21
86 0.19
87 0.17
88 0.2
89 0.15
90 0.15
91 0.2
92 0.2
93 0.23
94 0.23
95 0.22
96 0.22
97 0.22
98 0.22
99 0.24
100 0.32
101 0.37
102 0.44
103 0.5
104 0.56
105 0.66
106 0.71
107 0.7
108 0.68
109 0.66