Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y7SI13

Protein Details
Accession A0A4Y7SI13   
Localization Confidence Low
Confidence Score 5.8
NoLS Segment(s)
PositionSequenceProtein Nature
109-130LQESPRRLRSHRSHRPQRPLDKBasic
NLS Segment(s)
Subcellular Location(s) plas 14, E.R. 6, vacu 3, nucl 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MLHLLTAVVVYFYFKEKEPVDVPTVTALLVVVPTLSILLKNYLNLVSPVYGVTSCMLSFFAFYALLLSCMMAYRLSPRTPVPVSGPAPLQNKQALDYLPCIPRQAASLLQESPRRLRSHRSHRPQRPLDK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.17
3 0.18
4 0.23
5 0.24
6 0.27
7 0.28
8 0.27
9 0.27
10 0.23
11 0.22
12 0.16
13 0.14
14 0.1
15 0.06
16 0.06
17 0.05
18 0.03
19 0.03
20 0.03
21 0.03
22 0.03
23 0.04
24 0.05
25 0.07
26 0.08
27 0.08
28 0.1
29 0.1
30 0.1
31 0.1
32 0.1
33 0.08
34 0.08
35 0.08
36 0.07
37 0.07
38 0.07
39 0.06
40 0.06
41 0.06
42 0.06
43 0.06
44 0.05
45 0.06
46 0.05
47 0.06
48 0.05
49 0.05
50 0.05
51 0.05
52 0.05
53 0.05
54 0.05
55 0.04
56 0.04
57 0.05
58 0.04
59 0.04
60 0.08
61 0.11
62 0.11
63 0.13
64 0.14
65 0.19
66 0.2
67 0.21
68 0.21
69 0.25
70 0.26
71 0.26
72 0.27
73 0.27
74 0.3
75 0.3
76 0.29
77 0.25
78 0.24
79 0.24
80 0.25
81 0.2
82 0.18
83 0.19
84 0.22
85 0.22
86 0.22
87 0.21
88 0.19
89 0.19
90 0.19
91 0.19
92 0.18
93 0.18
94 0.21
95 0.22
96 0.27
97 0.31
98 0.32
99 0.35
100 0.37
101 0.38
102 0.38
103 0.46
104 0.52
105 0.59
106 0.68
107 0.73
108 0.78
109 0.84
110 0.93