Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A5E0D0

Protein Details
Accession A5E0D0    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MSKTSQPRQQHQQQQQQGPPFPHydrophilic
183-210QTIYKNRLMLHQRRKHEKEKSEKLQQEGHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21.5, cyto_nucl 13.333, mito_nucl 12.666, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR013640  Vfa1  
KEGG lel:LELG_03067  -  
Pfam View protein in Pfam  
PF08432  Vfa1  
Amino Acid Sequences MSKTSQPRQQHQQQQQQGPPFPNNYILRQVSLADSKPCMICFKPSSTVLVSENQHDFFYVCPSHLLDDQFATPIKPESYNLLHQEVKQINQSVAKLRKDMETEKPYLWGMSNYWKLNNNGDNPSTNDNDNDKEKSKSQEQNNDKDGKSKYETLKARLADQLQNLKEKEEEIKLFKFKKYQLEQTIYKNRLMLHQRRKHEKEKSEKLQQEGFFPQAPTHQLTN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.83
3 0.8
4 0.76
5 0.7
6 0.65
7 0.57
8 0.5
9 0.49
10 0.46
11 0.41
12 0.43
13 0.4
14 0.36
15 0.34
16 0.33
17 0.28
18 0.28
19 0.27
20 0.22
21 0.22
22 0.22
23 0.23
24 0.23
25 0.23
26 0.2
27 0.24
28 0.26
29 0.29
30 0.32
31 0.32
32 0.34
33 0.32
34 0.33
35 0.28
36 0.3
37 0.27
38 0.25
39 0.27
40 0.24
41 0.23
42 0.2
43 0.19
44 0.13
45 0.17
46 0.14
47 0.12
48 0.12
49 0.13
50 0.14
51 0.17
52 0.17
53 0.13
54 0.14
55 0.14
56 0.14
57 0.14
58 0.12
59 0.1
60 0.11
61 0.11
62 0.11
63 0.11
64 0.15
65 0.18
66 0.23
67 0.25
68 0.27
69 0.27
70 0.26
71 0.33
72 0.3
73 0.27
74 0.26
75 0.24
76 0.21
77 0.22
78 0.23
79 0.23
80 0.28
81 0.27
82 0.26
83 0.26
84 0.27
85 0.28
86 0.31
87 0.32
88 0.3
89 0.32
90 0.31
91 0.31
92 0.28
93 0.25
94 0.22
95 0.14
96 0.11
97 0.15
98 0.19
99 0.19
100 0.2
101 0.23
102 0.24
103 0.27
104 0.3
105 0.26
106 0.25
107 0.25
108 0.25
109 0.24
110 0.26
111 0.23
112 0.2
113 0.19
114 0.18
115 0.2
116 0.21
117 0.22
118 0.21
119 0.22
120 0.25
121 0.27
122 0.33
123 0.38
124 0.43
125 0.5
126 0.54
127 0.59
128 0.62
129 0.62
130 0.54
131 0.53
132 0.48
133 0.42
134 0.4
135 0.39
136 0.37
137 0.4
138 0.44
139 0.42
140 0.47
141 0.42
142 0.41
143 0.38
144 0.38
145 0.33
146 0.34
147 0.37
148 0.33
149 0.38
150 0.36
151 0.33
152 0.3
153 0.28
154 0.27
155 0.24
156 0.26
157 0.25
158 0.3
159 0.36
160 0.38
161 0.4
162 0.42
163 0.42
164 0.48
165 0.51
166 0.55
167 0.57
168 0.61
169 0.62
170 0.66
171 0.71
172 0.63
173 0.58
174 0.5
175 0.43
176 0.44
177 0.49
178 0.5
179 0.51
180 0.57
181 0.65
182 0.74
183 0.81
184 0.82
185 0.83
186 0.82
187 0.82
188 0.85
189 0.85
190 0.84
191 0.83
192 0.78
193 0.76
194 0.67
195 0.62
196 0.55
197 0.49
198 0.41
199 0.37
200 0.32
201 0.28
202 0.31