Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q752K0

Protein Details
Accession Q752K0    Localization Confidence Medium Confidence Score 14.9
NoLS Segment(s)
PositionSequenceProtein Nature
2-33VQKALKVTKKAKDPRRITKKQKNLKKAAPLQLHydrophilic
NLS Segment(s)
PositionSequence
7-44KVTKKAKDPRRITKKQKNLKKAAPLQLKSKKKSLQHMK
75-83RELEKTKKK
Subcellular Location(s) nucl 17, mito 9, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR019034  UPF0390  
KEGG ago:AGOS_AFR574W  -  
Pfam View protein in Pfam  
PF09495  DUF2462  
Amino Acid Sequences MVQKALKVTKKAKDPRRITKKQKNLKKAAPLQLKSKKKSLQHMKKLQKLSSLTEVTEKLVASRVGHLELVKGNRRELEKTKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.82
3 0.85
4 0.89
5 0.89
6 0.9
7 0.91
8 0.9
9 0.91
10 0.9
11 0.88
12 0.85
13 0.84
14 0.81
15 0.8
16 0.79
17 0.72
18 0.71
19 0.72
20 0.72
21 0.65
22 0.64
23 0.6
24 0.55
25 0.63
26 0.64
27 0.65
28 0.68
29 0.75
30 0.77
31 0.78
32 0.78
33 0.69
34 0.64
35 0.55
36 0.48
37 0.45
38 0.37
39 0.3
40 0.28
41 0.28
42 0.22
43 0.22
44 0.18
45 0.12
46 0.13
47 0.14
48 0.12
49 0.15
50 0.15
51 0.15
52 0.16
53 0.16
54 0.15
55 0.19
56 0.24
57 0.29
58 0.3
59 0.3
60 0.34
61 0.37
62 0.42
63 0.47