Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A5E7X9

Protein Details
Accession A5E7X9    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
177-198SSLQADNGKKQKKKRGLFGKKKBasic
NLS Segment(s)
PositionSequence
184-198GKKQKKKRGLFGKKK
Subcellular Location(s) nucl 23.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR018809  DUF2406  
KEGG lel:LELG_05718  -  
Pfam View protein in Pfam  
PF10295  DUF2406  
Amino Acid Sequences MAIFRSKSSNKTPQNADDINIKISAKDEEHYKYHSSNMHDPILTAVNEEQPFEQAANRVDNRRPSYLSQDSTDLKDIFGQPIRQTDMSNPTRSRNERPLDTIRGFEYAITGDVTYRDQLESSRLGWGFHEDFPYYNLQGGSAQDQQNGEGMRRPVINFDDHQGQEQAVYQAGNYSASSLQADNGKKQKKKRGLFGKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.62
3 0.55
4 0.51
5 0.46
6 0.39
7 0.35
8 0.3
9 0.21
10 0.21
11 0.23
12 0.17
13 0.17
14 0.2
15 0.23
16 0.26
17 0.29
18 0.31
19 0.28
20 0.31
21 0.34
22 0.36
23 0.39
24 0.41
25 0.4
26 0.37
27 0.36
28 0.34
29 0.32
30 0.25
31 0.19
32 0.15
33 0.17
34 0.18
35 0.18
36 0.16
37 0.14
38 0.15
39 0.14
40 0.14
41 0.11
42 0.13
43 0.19
44 0.21
45 0.24
46 0.27
47 0.35
48 0.38
49 0.38
50 0.39
51 0.35
52 0.41
53 0.43
54 0.42
55 0.35
56 0.35
57 0.34
58 0.33
59 0.34
60 0.26
61 0.2
62 0.2
63 0.19
64 0.17
65 0.18
66 0.18
67 0.15
68 0.18
69 0.2
70 0.19
71 0.18
72 0.18
73 0.25
74 0.27
75 0.31
76 0.3
77 0.31
78 0.36
79 0.4
80 0.42
81 0.41
82 0.42
83 0.38
84 0.43
85 0.44
86 0.43
87 0.41
88 0.36
89 0.28
90 0.26
91 0.24
92 0.18
93 0.13
94 0.08
95 0.08
96 0.07
97 0.06
98 0.05
99 0.06
100 0.07
101 0.06
102 0.07
103 0.06
104 0.06
105 0.07
106 0.09
107 0.1
108 0.1
109 0.13
110 0.13
111 0.13
112 0.13
113 0.18
114 0.17
115 0.17
116 0.19
117 0.15
118 0.15
119 0.17
120 0.19
121 0.15
122 0.14
123 0.13
124 0.12
125 0.12
126 0.13
127 0.15
128 0.18
129 0.19
130 0.19
131 0.19
132 0.19
133 0.21
134 0.21
135 0.18
136 0.16
137 0.17
138 0.17
139 0.19
140 0.19
141 0.19
142 0.21
143 0.24
144 0.21
145 0.24
146 0.29
147 0.28
148 0.29
149 0.26
150 0.24
151 0.21
152 0.22
153 0.19
154 0.12
155 0.11
156 0.09
157 0.1
158 0.1
159 0.11
160 0.09
161 0.1
162 0.1
163 0.11
164 0.13
165 0.11
166 0.13
167 0.19
168 0.21
169 0.27
170 0.36
171 0.45
172 0.5
173 0.59
174 0.68
175 0.72
176 0.78
177 0.81
178 0.83