Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Z1IQG8

Protein Details
Accession A0A4Z1IQG8   
Localization Confidence Medium
Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
278-310SGIVKPKPTPRVPKPPKEPKAPKEPKPAKEPKABasic
350-370ATPSSGKKRGRPAKEQTSDTPHydrophilic
NLS Segment(s)
PositionSequence
243-364REKPAPSGRGRGRPSKPDSEKKIKVPSGRGRGRPSSGIVKPKPTPRVPKPPKEPKAPKEPKPAKEPKAAKTPKSPKAKAVVEKKTPGKRGRPAKVPAAEGDVAEKPAATPSSGKKRGRPAKE
375-402PASKKRKAADDAGTPSSAGRGRPKKVKA
Subcellular Location(s) mito 17, nucl 5.5, cyto_nucl 5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR017956  AT_hook_DNA-bd_motif  
Gene Ontology GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF02178  AT_hook  
Amino Acid Sequences MLRSISNSLNPLFGSPRKSTVEDRFEGEKDQEFTMSSPNDITLAEFNQTLARYPALLNKYAKDTKEGVTPLQELDRFRYVEAPAKFKDGSNTFSIEDITKLVDWKLRHGAYRPGFLKKVGKNSDELVEAATKDAFDYYKTNPTDIGVVINKLKDPLMGIGPATASLILSVRYPDHVTFFSDECFKWLVNDGEHKPTPKYNVAEFEKIHAAAKSLATRLRVNPLQIEKVAFVIIKETEPVLVPREKPAPSGRGRGRPSKPDSEKKIKVPSGRGRGRPSSGIVKPKPTPRVPKPPKEPKAPKEPKPAKEPKAAKTPKSPKAKAVVEKKTPGKRGRPAKVPAAEGDVAEKPAATPSSGKKRGRPAKEQTSDTPASATPASKKRKAADDAGTPSSAGRGRPKKVKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.29
3 0.35
4 0.38
5 0.42
6 0.47
7 0.51
8 0.55
9 0.51
10 0.53
11 0.52
12 0.48
13 0.47
14 0.43
15 0.38
16 0.32
17 0.31
18 0.27
19 0.23
20 0.22
21 0.26
22 0.24
23 0.2
24 0.18
25 0.17
26 0.17
27 0.16
28 0.17
29 0.13
30 0.13
31 0.14
32 0.13
33 0.13
34 0.16
35 0.16
36 0.16
37 0.14
38 0.14
39 0.13
40 0.14
41 0.21
42 0.22
43 0.28
44 0.28
45 0.29
46 0.37
47 0.41
48 0.41
49 0.38
50 0.38
51 0.34
52 0.39
53 0.38
54 0.32
55 0.31
56 0.31
57 0.27
58 0.29
59 0.29
60 0.24
61 0.27
62 0.3
63 0.27
64 0.26
65 0.29
66 0.26
67 0.31
68 0.33
69 0.33
70 0.29
71 0.33
72 0.34
73 0.3
74 0.36
75 0.31
76 0.32
77 0.29
78 0.3
79 0.26
80 0.26
81 0.26
82 0.19
83 0.17
84 0.14
85 0.12
86 0.1
87 0.11
88 0.11
89 0.14
90 0.14
91 0.18
92 0.26
93 0.26
94 0.28
95 0.3
96 0.39
97 0.38
98 0.46
99 0.44
100 0.42
101 0.41
102 0.42
103 0.47
104 0.42
105 0.49
106 0.46
107 0.44
108 0.41
109 0.42
110 0.41
111 0.34
112 0.29
113 0.2
114 0.16
115 0.15
116 0.13
117 0.11
118 0.08
119 0.07
120 0.08
121 0.07
122 0.07
123 0.1
124 0.13
125 0.21
126 0.21
127 0.22
128 0.21
129 0.21
130 0.21
131 0.19
132 0.19
133 0.12
134 0.13
135 0.14
136 0.15
137 0.14
138 0.13
139 0.13
140 0.09
141 0.09
142 0.09
143 0.09
144 0.09
145 0.09
146 0.08
147 0.08
148 0.08
149 0.07
150 0.05
151 0.04
152 0.04
153 0.04
154 0.04
155 0.04
156 0.05
157 0.05
158 0.07
159 0.09
160 0.09
161 0.11
162 0.11
163 0.13
164 0.14
165 0.14
166 0.14
167 0.15
168 0.14
169 0.14
170 0.14
171 0.12
172 0.11
173 0.13
174 0.14
175 0.13
176 0.19
177 0.19
178 0.24
179 0.25
180 0.26
181 0.24
182 0.25
183 0.27
184 0.26
185 0.26
186 0.23
187 0.29
188 0.32
189 0.34
190 0.32
191 0.3
192 0.27
193 0.25
194 0.24
195 0.16
196 0.13
197 0.11
198 0.12
199 0.11
200 0.12
201 0.13
202 0.15
203 0.17
204 0.17
205 0.22
206 0.22
207 0.21
208 0.24
209 0.25
210 0.25
211 0.23
212 0.23
213 0.17
214 0.16
215 0.16
216 0.11
217 0.08
218 0.08
219 0.08
220 0.07
221 0.07
222 0.07
223 0.07
224 0.07
225 0.08
226 0.1
227 0.13
228 0.13
229 0.16
230 0.21
231 0.21
232 0.23
233 0.27
234 0.3
235 0.31
236 0.4
237 0.42
238 0.46
239 0.5
240 0.56
241 0.57
242 0.59
243 0.62
244 0.63
245 0.66
246 0.66
247 0.71
248 0.72
249 0.72
250 0.7
251 0.73
252 0.67
253 0.64
254 0.64
255 0.64
256 0.65
257 0.67
258 0.67
259 0.64
260 0.63
261 0.61
262 0.54
263 0.49
264 0.46
265 0.44
266 0.47
267 0.44
268 0.46
269 0.48
270 0.53
271 0.57
272 0.56
273 0.61
274 0.6
275 0.7
276 0.72
277 0.78
278 0.81
279 0.84
280 0.85
281 0.86
282 0.87
283 0.82
284 0.84
285 0.83
286 0.81
287 0.81
288 0.83
289 0.78
290 0.79
291 0.82
292 0.76
293 0.77
294 0.75
295 0.7
296 0.72
297 0.72
298 0.66
299 0.67
300 0.71
301 0.7
302 0.74
303 0.7
304 0.65
305 0.68
306 0.71
307 0.69
308 0.7
309 0.7
310 0.67
311 0.72
312 0.75
313 0.74
314 0.75
315 0.74
316 0.73
317 0.73
318 0.76
319 0.77
320 0.77
321 0.75
322 0.75
323 0.72
324 0.65
325 0.57
326 0.53
327 0.45
328 0.36
329 0.34
330 0.25
331 0.21
332 0.19
333 0.17
334 0.11
335 0.14
336 0.14
337 0.12
338 0.15
339 0.23
340 0.35
341 0.44
342 0.48
343 0.51
344 0.62
345 0.71
346 0.75
347 0.76
348 0.75
349 0.77
350 0.81
351 0.8
352 0.74
353 0.72
354 0.66
355 0.56
356 0.48
357 0.37
358 0.32
359 0.28
360 0.26
361 0.26
362 0.33
363 0.42
364 0.46
365 0.52
366 0.54
367 0.62
368 0.65
369 0.65
370 0.63
371 0.64
372 0.64
373 0.62
374 0.56
375 0.47
376 0.41
377 0.37
378 0.32
379 0.27
380 0.31
381 0.36
382 0.44