Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A5E6I4

Protein Details
Accession A5E6I4    Localization Confidence High Confidence Score 19.7
NoLS Segment(s)
PositionSequenceProtein Nature
91-117IDESESKPTRRRRQKRTPKAKSKVEHFBasic
135-161EIKKTEAKPRAFKRRRKPEVLNKVKSIBasic
210-232SNPPSQSRLQSPKRKPAKPTSSFHydrophilic
NLS Segment(s)
PositionSequence
97-113KPTRRRRQKRTPKAKSK
137-152KKTEAKPRAFKRRRKP
Subcellular Location(s) nucl 23, cyto_nucl 13.333, mito_nucl 12.833
Family & Domain DBs
KEGG lel:LELG_05223  -  
Amino Acid Sequences MLICDDSVQRACPSVKTTPNGRSGLRSPEKRLIIDLDQSAKKRAKRTLYSRLMQEYEDSSENELAGQELKLAEKILDEYNVNYGSDVELEIDESESKPTRRRRQKRTPKAKSKVEHFLEDSMDSDLDVDYEAEKEIKKTEAKPRAFKRRRKPEVLNKVKSIFQQDDDMFGLLQSLKASSSSPAPAFAPVSEPASTPAFESTSALEPASESNPPSQSRLQSPKRKPAKPTSSFAETLLQSNQYTNT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.37
3 0.4
4 0.46
5 0.49
6 0.56
7 0.56
8 0.53
9 0.51
10 0.48
11 0.53
12 0.56
13 0.54
14 0.53
15 0.58
16 0.6
17 0.55
18 0.53
19 0.48
20 0.41
21 0.4
22 0.37
23 0.35
24 0.36
25 0.37
26 0.41
27 0.41
28 0.42
29 0.44
30 0.49
31 0.52
32 0.57
33 0.64
34 0.69
35 0.72
36 0.72
37 0.7
38 0.68
39 0.59
40 0.5
41 0.43
42 0.34
43 0.29
44 0.26
45 0.22
46 0.18
47 0.17
48 0.16
49 0.15
50 0.12
51 0.09
52 0.08
53 0.08
54 0.06
55 0.06
56 0.07
57 0.07
58 0.07
59 0.07
60 0.07
61 0.09
62 0.09
63 0.1
64 0.1
65 0.1
66 0.13
67 0.14
68 0.13
69 0.11
70 0.1
71 0.09
72 0.09
73 0.08
74 0.06
75 0.05
76 0.05
77 0.05
78 0.06
79 0.06
80 0.06
81 0.08
82 0.1
83 0.12
84 0.18
85 0.28
86 0.38
87 0.49
88 0.59
89 0.67
90 0.76
91 0.86
92 0.91
93 0.93
94 0.94
95 0.93
96 0.92
97 0.91
98 0.84
99 0.79
100 0.77
101 0.68
102 0.59
103 0.5
104 0.42
105 0.34
106 0.29
107 0.24
108 0.14
109 0.11
110 0.08
111 0.07
112 0.05
113 0.05
114 0.04
115 0.04
116 0.03
117 0.04
118 0.04
119 0.05
120 0.05
121 0.06
122 0.07
123 0.1
124 0.12
125 0.17
126 0.27
127 0.35
128 0.41
129 0.49
130 0.57
131 0.66
132 0.73
133 0.77
134 0.78
135 0.8
136 0.83
137 0.83
138 0.84
139 0.83
140 0.85
141 0.87
142 0.81
143 0.73
144 0.67
145 0.61
146 0.53
147 0.48
148 0.39
149 0.3
150 0.3
151 0.26
152 0.27
153 0.25
154 0.23
155 0.17
156 0.15
157 0.14
158 0.08
159 0.09
160 0.06
161 0.05
162 0.05
163 0.06
164 0.07
165 0.07
166 0.1
167 0.13
168 0.13
169 0.14
170 0.14
171 0.15
172 0.16
173 0.15
174 0.15
175 0.13
176 0.16
177 0.15
178 0.15
179 0.16
180 0.17
181 0.17
182 0.14
183 0.15
184 0.13
185 0.12
186 0.13
187 0.13
188 0.15
189 0.15
190 0.14
191 0.13
192 0.12
193 0.14
194 0.16
195 0.14
196 0.13
197 0.16
198 0.21
199 0.22
200 0.26
201 0.29
202 0.31
203 0.39
204 0.48
205 0.55
206 0.61
207 0.68
208 0.74
209 0.8
210 0.82
211 0.81
212 0.82
213 0.83
214 0.79
215 0.77
216 0.73
217 0.7
218 0.64
219 0.57
220 0.52
221 0.42
222 0.38
223 0.35
224 0.3
225 0.24