Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Z1HYE0

Protein Details
Accession A0A4Z1HYE0    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
31-61AGKEGRNRNEKRREEKKRKAKKGKLFDICYDBasic
NLS Segment(s)
PositionSequence
32-54GKEGRNRNEKRREEKKRKAKKGK
Subcellular Location(s) nucl 17, mito_nucl 12.833, cyto_nucl 10.333, mito 7.5
Family & Domain DBs
Amino Acid Sequences MKSIKSQVWMFPSDSTCQMPTKGPTTRDSNAGKEGRNRNEKRREEKKRKAKKGKLFDICYDAMTRTTYD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.28
3 0.25
4 0.24
5 0.23
6 0.23
7 0.23
8 0.27
9 0.29
10 0.29
11 0.31
12 0.36
13 0.36
14 0.4
15 0.39
16 0.36
17 0.38
18 0.38
19 0.36
20 0.37
21 0.42
22 0.43
23 0.51
24 0.52
25 0.55
26 0.63
27 0.69
28 0.71
29 0.75
30 0.79
31 0.8
32 0.87
33 0.89
34 0.89
35 0.93
36 0.94
37 0.93
38 0.92
39 0.92
40 0.92
41 0.91
42 0.85
43 0.77
44 0.71
45 0.62
46 0.53
47 0.44
48 0.34
49 0.26