Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q75CS0

Protein Details
Accession Q75CS0    Localization Confidence Low Confidence Score 8.2
NoLS Segment(s)
PositionSequenceProtein Nature
144-163LTYLELRKRNWRYHKTLKVWHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11, cyto_nucl 9.5, cyto 6, mito 5, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR038635  CCR4-NOT_su2/3/5_C_sf  
IPR040168  Not2/3/5  
IPR007282  NOT2/3/5_C  
Gene Ontology GO:0030015  C:CCR4-NOT core complex  
GO:0005737  C:cytoplasm  
GO:0005634  C:nucleus  
GO:0000290  P:deadenylation-dependent decapping of nuclear-transcribed mRNA  
GO:0031087  P:deadenylation-independent decapping of nuclear-transcribed mRNA  
GO:0000289  P:nuclear-transcribed mRNA poly(A) tail shortening  
GO:0032968  P:positive regulation of transcription elongation by RNA polymerase II  
GO:0016567  P:protein ubiquitination  
GO:0051726  P:regulation of cell cycle  
GO:0000749  P:response to pheromone triggering conjugation with cellular fusion  
GO:0006368  P:transcription elongation by RNA polymerase II  
KEGG ago:AGOS_ACL151C  -  
Pfam View protein in Pfam  
PF04153  NOT2_3_5  
Amino Acid Sequences MVPMPHVAPSKAVEQLNMDKYGLKGLLPVIKHEKQYDAFMTLGVDVSSLLHSLQVSSKDGYNTALSNGHHALDTFPSPWVETSRSEVEPKFFIPESFCNIGGVLGQASTDFTSVARDHPRISLLQDETLFYLFYKHPGTVLQELTYLELRKRNWRYHKTLKVWLTKDPLMEPIVSQDSTSERGSYVFFDPQRWEKCQRDFILNYSAIM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.33
3 0.35
4 0.34
5 0.32
6 0.27
7 0.27
8 0.29
9 0.24
10 0.17
11 0.14
12 0.15
13 0.2
14 0.18
15 0.24
16 0.28
17 0.32
18 0.35
19 0.35
20 0.37
21 0.34
22 0.38
23 0.35
24 0.29
25 0.25
26 0.22
27 0.21
28 0.16
29 0.15
30 0.1
31 0.08
32 0.05
33 0.06
34 0.06
35 0.05
36 0.05
37 0.06
38 0.06
39 0.07
40 0.09
41 0.11
42 0.13
43 0.14
44 0.15
45 0.15
46 0.16
47 0.17
48 0.16
49 0.14
50 0.13
51 0.15
52 0.14
53 0.17
54 0.17
55 0.15
56 0.14
57 0.14
58 0.13
59 0.11
60 0.13
61 0.1
62 0.1
63 0.1
64 0.1
65 0.11
66 0.12
67 0.12
68 0.12
69 0.16
70 0.19
71 0.2
72 0.22
73 0.22
74 0.22
75 0.21
76 0.2
77 0.19
78 0.15
79 0.14
80 0.15
81 0.16
82 0.19
83 0.2
84 0.19
85 0.16
86 0.16
87 0.16
88 0.13
89 0.11
90 0.06
91 0.04
92 0.03
93 0.03
94 0.03
95 0.04
96 0.04
97 0.04
98 0.04
99 0.06
100 0.07
101 0.1
102 0.13
103 0.14
104 0.15
105 0.16
106 0.17
107 0.15
108 0.16
109 0.18
110 0.16
111 0.17
112 0.16
113 0.16
114 0.15
115 0.15
116 0.14
117 0.09
118 0.11
119 0.08
120 0.11
121 0.12
122 0.11
123 0.11
124 0.13
125 0.17
126 0.18
127 0.19
128 0.16
129 0.16
130 0.16
131 0.18
132 0.19
133 0.16
134 0.14
135 0.18
136 0.2
137 0.28
138 0.35
139 0.43
140 0.51
141 0.59
142 0.66
143 0.73
144 0.81
145 0.77
146 0.8
147 0.78
148 0.77
149 0.7
150 0.67
151 0.62
152 0.54
153 0.49
154 0.41
155 0.36
156 0.28
157 0.26
158 0.21
159 0.19
160 0.2
161 0.18
162 0.17
163 0.15
164 0.16
165 0.19
166 0.2
167 0.16
168 0.13
169 0.14
170 0.15
171 0.17
172 0.18
173 0.22
174 0.22
175 0.24
176 0.3
177 0.38
178 0.42
179 0.45
180 0.5
181 0.51
182 0.58
183 0.64
184 0.62
185 0.62
186 0.59
187 0.58
188 0.58