Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Z1HPA9

Protein Details
Accession A0A4Z1HPA9    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
5-28VDTMTLSDRQRKPKDPNLPPENEIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15.5, cyto_nucl 13, cyto 9.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016181  Acyl_CoA_acyltransferase  
IPR039661  ELP3  
IPR034687  ELP3-like  
IPR006638  Elp3/MiaA/NifB-like_rSAM  
IPR000182  GNAT_dom  
IPR032432  Radical_SAM_C  
IPR007197  rSAM  
Gene Ontology GO:0051539  F:4 iron, 4 sulfur cluster binding  
GO:0046872  F:metal ion binding  
GO:0000049  F:tRNA binding  
GO:0106261  F:tRNA uridine(34) acetyltransferase activity  
GO:0008033  P:tRNA processing  
Pfam View protein in Pfam  
PF00583  Acetyltransf_1  
PF04055  Radical_SAM  
PF16199  Radical_SAM_C  
PROSITE View protein in PROSITE  
PS51186  GNAT  
PS51918  RADICAL_SAM  
CDD cd04301  NAT_SF  
cd01335  Radical_SAM  
Amino Acid Sequences MATTVDTMTLSDRQRKPKDPNLPPENEIYLRACSDIASALVQDHESQQDPNAPRKDINLNSLRVKMSKRHRLSNIPPLTAIIAAIPEHYKKYILPKLIAKPIRSASGIAVVAVMCKPHRCPHIAYTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDPFEQARGRVDQIKSLGHSVDKVEYIIMGGTFMSLSESYRDGFISQLHNALSGYQGNNVDEAVQAGEMSNIKCVGITIETRPDYCLQPHLSAMLRYGCTRLEIGVQSLYEDVARDTNRGHTVASVADTFCLAKDAGFKVVSHMMPDLPNVGMERDLDQFREYFENPAFRTDGLKIYPTLVIRGTGLYELWRTGRYKNYTPNALIDIVARILALVPPWTRIYRVQRDIPMPLVTSGVENGNLRELALSRMKDFGTTCRDVRTREVGINEVKNKIRPSQVELVRRDYTANKGWETFLAYEDPKQDILIGLLRLRKCSKTHTFRPELTGQPTSIIRELHVYGSAVPVHARDPRKFQHQGYGTLLMEEAERIARNEHGSTKISVISGVGTRDYYRRLGYCLDGPYMSKMLPPKDDEDSDDDF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.64
3 0.71
4 0.74
5 0.81
6 0.81
7 0.84
8 0.84
9 0.81
10 0.74
11 0.7
12 0.65
13 0.56
14 0.48
15 0.4
16 0.33
17 0.28
18 0.26
19 0.21
20 0.16
21 0.16
22 0.14
23 0.12
24 0.1
25 0.1
26 0.1
27 0.11
28 0.11
29 0.11
30 0.12
31 0.14
32 0.15
33 0.15
34 0.17
35 0.24
36 0.27
37 0.35
38 0.38
39 0.38
40 0.37
41 0.42
42 0.49
43 0.44
44 0.5
45 0.48
46 0.48
47 0.5
48 0.53
49 0.5
50 0.45
51 0.45
52 0.45
53 0.49
54 0.54
55 0.56
56 0.62
57 0.67
58 0.73
59 0.77
60 0.79
61 0.75
62 0.66
63 0.6
64 0.51
65 0.45
66 0.35
67 0.27
68 0.16
69 0.1
70 0.08
71 0.1
72 0.11
73 0.11
74 0.13
75 0.14
76 0.15
77 0.16
78 0.26
79 0.31
80 0.34
81 0.37
82 0.43
83 0.5
84 0.58
85 0.61
86 0.53
87 0.53
88 0.5
89 0.48
90 0.42
91 0.36
92 0.27
93 0.28
94 0.26
95 0.2
96 0.18
97 0.14
98 0.14
99 0.13
100 0.13
101 0.09
102 0.11
103 0.14
104 0.2
105 0.25
106 0.27
107 0.32
108 0.36
109 0.45
110 0.47
111 0.45
112 0.45
113 0.45
114 0.42
115 0.38
116 0.32
117 0.22
118 0.2
119 0.18
120 0.14
121 0.11
122 0.11
123 0.12
124 0.13
125 0.17
126 0.18
127 0.18
128 0.17
129 0.19
130 0.18
131 0.18
132 0.16
133 0.13
134 0.11
135 0.12
136 0.14
137 0.11
138 0.12
139 0.12
140 0.14
141 0.19
142 0.18
143 0.19
144 0.21
145 0.21
146 0.23
147 0.29
148 0.3
149 0.29
150 0.32
151 0.37
152 0.35
153 0.41
154 0.38
155 0.34
156 0.34
157 0.33
158 0.32
159 0.32
160 0.3
161 0.27
162 0.28
163 0.28
164 0.25
165 0.25
166 0.23
167 0.17
168 0.18
169 0.15
170 0.15
171 0.13
172 0.12
173 0.1
174 0.09
175 0.09
176 0.08
177 0.06
178 0.05
179 0.04
180 0.04
181 0.04
182 0.04
183 0.05
184 0.04
185 0.05
186 0.06
187 0.07
188 0.08
189 0.08
190 0.09
191 0.08
192 0.09
193 0.1
194 0.12
195 0.12
196 0.14
197 0.13
198 0.13
199 0.13
200 0.12
201 0.11
202 0.1
203 0.1
204 0.11
205 0.12
206 0.12
207 0.12
208 0.12
209 0.11
210 0.08
211 0.08
212 0.05
213 0.04
214 0.04
215 0.04
216 0.05
217 0.06
218 0.07
219 0.07
220 0.07
221 0.07
222 0.07
223 0.07
224 0.07
225 0.07
226 0.08
227 0.09
228 0.15
229 0.16
230 0.16
231 0.18
232 0.18
233 0.18
234 0.18
235 0.21
236 0.17
237 0.18
238 0.18
239 0.18
240 0.17
241 0.16
242 0.17
243 0.15
244 0.13
245 0.13
246 0.13
247 0.11
248 0.11
249 0.11
250 0.1
251 0.1
252 0.09
253 0.1
254 0.1
255 0.1
256 0.09
257 0.09
258 0.08
259 0.06
260 0.06
261 0.05
262 0.07
263 0.08
264 0.08
265 0.09
266 0.12
267 0.13
268 0.13
269 0.13
270 0.1
271 0.11
272 0.11
273 0.11
274 0.09
275 0.07
276 0.07
277 0.07
278 0.06
279 0.05
280 0.06
281 0.05
282 0.05
283 0.07
284 0.08
285 0.1
286 0.11
287 0.11
288 0.12
289 0.16
290 0.15
291 0.13
292 0.13
293 0.12
294 0.11
295 0.12
296 0.11
297 0.07
298 0.07
299 0.07
300 0.07
301 0.06
302 0.06
303 0.08
304 0.1
305 0.1
306 0.11
307 0.11
308 0.11
309 0.12
310 0.14
311 0.13
312 0.13
313 0.15
314 0.18
315 0.18
316 0.2
317 0.19
318 0.16
319 0.18
320 0.16
321 0.17
322 0.14
323 0.15
324 0.13
325 0.14
326 0.16
327 0.14
328 0.14
329 0.12
330 0.11
331 0.1
332 0.1
333 0.09
334 0.07
335 0.07
336 0.07
337 0.07
338 0.07
339 0.08
340 0.1
341 0.11
342 0.14
343 0.21
344 0.26
345 0.31
346 0.38
347 0.42
348 0.44
349 0.44
350 0.43
351 0.37
352 0.32
353 0.28
354 0.2
355 0.15
356 0.11
357 0.1
358 0.08
359 0.05
360 0.05
361 0.05
362 0.04
363 0.06
364 0.07
365 0.09
366 0.11
367 0.12
368 0.14
369 0.2
370 0.29
371 0.36
372 0.41
373 0.44
374 0.47
375 0.49
376 0.49
377 0.45
378 0.37
379 0.29
380 0.24
381 0.19
382 0.14
383 0.12
384 0.11
385 0.09
386 0.1
387 0.09
388 0.09
389 0.1
390 0.1
391 0.09
392 0.09
393 0.09
394 0.11
395 0.16
396 0.16
397 0.16
398 0.18
399 0.18
400 0.19
401 0.19
402 0.21
403 0.24
404 0.27
405 0.27
406 0.31
407 0.34
408 0.34
409 0.38
410 0.39
411 0.34
412 0.34
413 0.35
414 0.32
415 0.35
416 0.39
417 0.37
418 0.36
419 0.35
420 0.36
421 0.37
422 0.37
423 0.38
424 0.34
425 0.38
426 0.42
427 0.48
428 0.52
429 0.53
430 0.56
431 0.51
432 0.49
433 0.45
434 0.37
435 0.36
436 0.34
437 0.35
438 0.3
439 0.29
440 0.3
441 0.29
442 0.3
443 0.25
444 0.19
445 0.19
446 0.18
447 0.19
448 0.21
449 0.21
450 0.18
451 0.17
452 0.16
453 0.13
454 0.13
455 0.14
456 0.13
457 0.15
458 0.2
459 0.21
460 0.26
461 0.29
462 0.31
463 0.3
464 0.38
465 0.46
466 0.5
467 0.59
468 0.65
469 0.69
470 0.68
471 0.72
472 0.69
473 0.64
474 0.6
475 0.52
476 0.42
477 0.38
478 0.36
479 0.33
480 0.29
481 0.24
482 0.19
483 0.2
484 0.21
485 0.19
486 0.19
487 0.17
488 0.14
489 0.16
490 0.16
491 0.13
492 0.12
493 0.12
494 0.13
495 0.2
496 0.26
497 0.27
498 0.35
499 0.4
500 0.49
501 0.55
502 0.54
503 0.57
504 0.56
505 0.58
506 0.55
507 0.55
508 0.45
509 0.39
510 0.37
511 0.27
512 0.22
513 0.17
514 0.12
515 0.09
516 0.1
517 0.1
518 0.12
519 0.15
520 0.18
521 0.21
522 0.24
523 0.26
524 0.28
525 0.29
526 0.29
527 0.28
528 0.25
529 0.22
530 0.19
531 0.17
532 0.16
533 0.16
534 0.15
535 0.14
536 0.16
537 0.19
538 0.22
539 0.23
540 0.26
541 0.26
542 0.27
543 0.29
544 0.32
545 0.34
546 0.34
547 0.34
548 0.3
549 0.3
550 0.31
551 0.3
552 0.26
553 0.24
554 0.26
555 0.29
556 0.33
557 0.35
558 0.36
559 0.4
560 0.42
561 0.43