Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Z1HPS6

Protein Details
Accession A0A4Z1HPS6    Localization Confidence Low Confidence Score 7.1
NoLS Segment(s)
PositionSequenceProtein Nature
382-402LADRRFLKKRTQLPKWINQAIHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 13.5, cyto_nucl 11, nucl 7.5, cysk 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR006555  ATP-dep_Helicase_C  
IPR045028  DinG/Rad3-like  
IPR010643  HBB  
IPR027417  P-loop_NTPase  
IPR013020  Rad3/Chl1-like  
IPR001945  RAD3/XPD  
Gene Ontology GO:0005634  C:nucleus  
GO:0005524  F:ATP binding  
GO:0003677  F:DNA binding  
GO:0003678  F:DNA helicase activity  
GO:0016818  F:hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides  
GO:0006289  P:nucleotide-excision repair  
Pfam View protein in Pfam  
PF06777  HBB  
PF13307  Helicase_C_2  
CDD cd18788  SF2_C_XPD  
Amino Acid Sequences MSNPALPDDLLKEAVPGNIRRAEHFVVFLKRFIEYLKLAANLKKTRMKVRQVISETPASFLAHLKEYTYIEKKPLGFCAERLTSLVRTLELTNIEDYQPLQEVATFATLVATYEKGFLLILEPYESDTAEVPNPVLHFTCLDAAIAIKPVFERFSSVIITSGTISPLEMYPKMLNFECVVQESYPMTLARRSFLPMIVTRGSDQVAISSGFQVRNEPAVVRNYGNLLTEMSKLTPDGMVVFFPSYLYMESIISMWQGMGILDEVWKYKLILVETPDAQETSLALETYRTACCNGRGAILLCVARGKVSEGIDFDHQYGLTVLCIGVPFQYTESRILKARLEFLRETYRIRENDFLSFDAMRHAAQCLGRVLRGKDDYGIMVLADRRFLKKRTQLPKWINQAILDSEVNLSTDMAVGSAKKFLRNMAQSFKVKDQEGISTWSLQDLEKFKEKQYEETLQALRGGGKGDPMDGIKNGNEQTVKEDEYGMDDDEMEASMMQLDA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.23
3 0.23
4 0.26
5 0.31
6 0.32
7 0.33
8 0.38
9 0.38
10 0.34
11 0.36
12 0.37
13 0.39
14 0.4
15 0.39
16 0.34
17 0.31
18 0.3
19 0.27
20 0.26
21 0.19
22 0.2
23 0.22
24 0.25
25 0.27
26 0.31
27 0.38
28 0.38
29 0.43
30 0.47
31 0.48
32 0.56
33 0.62
34 0.67
35 0.67
36 0.69
37 0.72
38 0.71
39 0.71
40 0.65
41 0.63
42 0.54
43 0.47
44 0.41
45 0.32
46 0.26
47 0.24
48 0.22
49 0.18
50 0.18
51 0.17
52 0.19
53 0.21
54 0.27
55 0.3
56 0.29
57 0.29
58 0.34
59 0.36
60 0.36
61 0.38
62 0.37
63 0.33
64 0.33
65 0.37
66 0.34
67 0.31
68 0.31
69 0.29
70 0.24
71 0.25
72 0.25
73 0.17
74 0.17
75 0.17
76 0.19
77 0.17
78 0.18
79 0.17
80 0.17
81 0.17
82 0.16
83 0.15
84 0.14
85 0.13
86 0.12
87 0.1
88 0.09
89 0.09
90 0.1
91 0.1
92 0.09
93 0.07
94 0.07
95 0.07
96 0.07
97 0.08
98 0.08
99 0.07
100 0.08
101 0.08
102 0.08
103 0.08
104 0.07
105 0.08
106 0.08
107 0.08
108 0.08
109 0.08
110 0.09
111 0.1
112 0.1
113 0.09
114 0.09
115 0.1
116 0.1
117 0.1
118 0.09
119 0.1
120 0.1
121 0.11
122 0.11
123 0.1
124 0.09
125 0.1
126 0.11
127 0.1
128 0.09
129 0.08
130 0.08
131 0.08
132 0.1
133 0.09
134 0.08
135 0.08
136 0.09
137 0.11
138 0.1
139 0.13
140 0.11
141 0.14
142 0.15
143 0.15
144 0.15
145 0.14
146 0.14
147 0.12
148 0.11
149 0.09
150 0.08
151 0.08
152 0.07
153 0.08
154 0.1
155 0.09
156 0.11
157 0.12
158 0.13
159 0.15
160 0.15
161 0.15
162 0.14
163 0.15
164 0.13
165 0.14
166 0.14
167 0.12
168 0.13
169 0.12
170 0.11
171 0.12
172 0.11
173 0.1
174 0.12
175 0.12
176 0.12
177 0.13
178 0.15
179 0.14
180 0.15
181 0.18
182 0.16
183 0.2
184 0.19
185 0.19
186 0.17
187 0.18
188 0.17
189 0.14
190 0.12
191 0.08
192 0.09
193 0.08
194 0.08
195 0.08
196 0.1
197 0.1
198 0.1
199 0.11
200 0.11
201 0.12
202 0.12
203 0.11
204 0.12
205 0.14
206 0.15
207 0.14
208 0.14
209 0.14
210 0.14
211 0.14
212 0.11
213 0.1
214 0.09
215 0.1
216 0.1
217 0.09
218 0.08
219 0.08
220 0.08
221 0.07
222 0.06
223 0.06
224 0.06
225 0.05
226 0.06
227 0.06
228 0.05
229 0.05
230 0.06
231 0.05
232 0.05
233 0.05
234 0.05
235 0.05
236 0.06
237 0.06
238 0.06
239 0.05
240 0.05
241 0.04
242 0.03
243 0.03
244 0.03
245 0.03
246 0.03
247 0.03
248 0.04
249 0.04
250 0.05
251 0.05
252 0.06
253 0.06
254 0.07
255 0.09
256 0.09
257 0.11
258 0.13
259 0.15
260 0.15
261 0.16
262 0.15
263 0.13
264 0.12
265 0.1
266 0.07
267 0.07
268 0.06
269 0.06
270 0.05
271 0.06
272 0.07
273 0.09
274 0.09
275 0.08
276 0.1
277 0.11
278 0.12
279 0.15
280 0.15
281 0.14
282 0.15
283 0.16
284 0.15
285 0.17
286 0.15
287 0.12
288 0.12
289 0.11
290 0.09
291 0.08
292 0.09
293 0.1
294 0.11
295 0.12
296 0.12
297 0.14
298 0.16
299 0.17
300 0.16
301 0.13
302 0.12
303 0.11
304 0.11
305 0.09
306 0.07
307 0.06
308 0.05
309 0.05
310 0.05
311 0.05
312 0.05
313 0.05
314 0.06
315 0.07
316 0.09
317 0.1
318 0.15
319 0.17
320 0.19
321 0.2
322 0.22
323 0.24
324 0.23
325 0.29
326 0.26
327 0.29
328 0.28
329 0.3
330 0.36
331 0.34
332 0.35
333 0.32
334 0.37
335 0.33
336 0.36
337 0.37
338 0.31
339 0.34
340 0.33
341 0.3
342 0.25
343 0.24
344 0.21
345 0.18
346 0.17
347 0.13
348 0.11
349 0.11
350 0.12
351 0.12
352 0.14
353 0.16
354 0.16
355 0.18
356 0.22
357 0.23
358 0.26
359 0.27
360 0.26
361 0.24
362 0.24
363 0.22
364 0.18
365 0.17
366 0.1
367 0.1
368 0.12
369 0.11
370 0.13
371 0.14
372 0.18
373 0.23
374 0.25
375 0.33
376 0.39
377 0.49
378 0.56
379 0.63
380 0.69
381 0.74
382 0.8
383 0.8
384 0.76
385 0.67
386 0.58
387 0.52
388 0.43
389 0.38
390 0.28
391 0.2
392 0.16
393 0.15
394 0.14
395 0.12
396 0.1
397 0.06
398 0.07
399 0.06
400 0.06
401 0.06
402 0.07
403 0.07
404 0.13
405 0.14
406 0.16
407 0.17
408 0.2
409 0.28
410 0.35
411 0.39
412 0.41
413 0.49
414 0.51
415 0.54
416 0.57
417 0.53
418 0.47
419 0.45
420 0.4
421 0.36
422 0.34
423 0.35
424 0.3
425 0.27
426 0.26
427 0.24
428 0.23
429 0.18
430 0.22
431 0.2
432 0.25
433 0.31
434 0.33
435 0.35
436 0.43
437 0.44
438 0.45
439 0.49
440 0.5
441 0.46
442 0.51
443 0.5
444 0.42
445 0.42
446 0.36
447 0.29
448 0.23
449 0.21
450 0.14
451 0.16
452 0.15
453 0.15
454 0.16
455 0.16
456 0.18
457 0.17
458 0.2
459 0.17
460 0.22
461 0.22
462 0.25
463 0.25
464 0.23
465 0.27
466 0.29
467 0.3
468 0.25
469 0.26
470 0.21
471 0.24
472 0.25
473 0.21
474 0.17
475 0.15
476 0.15
477 0.14
478 0.14
479 0.1
480 0.08
481 0.06