Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Z1HS40

Protein Details
Accession A0A4Z1HS40    Localization Confidence High Confidence Score 20.9
NoLS Segment(s)
PositionSequenceProtein Nature
7-33EEPDSQRKEHNRQESCRTRKSRNPLKGHydrophilic
97-116KAPKAPKAPKAPKAPKTPKDBasic
143-162ITSKHKTKKGGPKTTPFVPKHydrophilic
NLS Segment(s)
PositionSequence
90-115PKAPKSPKAPKAPKAPKAPKAPKTPK
149-153TKKGG
Subcellular Location(s) nucl 22.5, cyto_nucl 13, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MKRKDPEEPDSQRKEHNRQESCRTRKSRNPLKGLSIDSPEHWRIYNKTSPGGSVSDDSDDSVQEVPPPPANARFRTPPRDYRFMFPSPEPKAPKSPKAPKAPKAPKAPKAPKTPKDEPAAWFCPYCNEKAGGYLKKGSCASHITSKHKTKKGGPKTTPFVPKVRDRKIVFPAGFLNDTA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.71
3 0.72
4 0.71
5 0.7
6 0.78
7 0.8
8 0.8
9 0.81
10 0.78
11 0.76
12 0.76
13 0.81
14 0.81
15 0.8
16 0.8
17 0.74
18 0.74
19 0.71
20 0.67
21 0.59
22 0.53
23 0.44
24 0.38
25 0.39
26 0.34
27 0.3
28 0.26
29 0.26
30 0.25
31 0.3
32 0.34
33 0.3
34 0.32
35 0.31
36 0.31
37 0.3
38 0.28
39 0.23
40 0.18
41 0.17
42 0.14
43 0.14
44 0.14
45 0.12
46 0.1
47 0.1
48 0.09
49 0.08
50 0.08
51 0.1
52 0.1
53 0.12
54 0.13
55 0.14
56 0.2
57 0.24
58 0.25
59 0.28
60 0.34
61 0.37
62 0.44
63 0.47
64 0.5
65 0.52
66 0.57
67 0.55
68 0.51
69 0.51
70 0.46
71 0.44
72 0.36
73 0.37
74 0.34
75 0.38
76 0.37
77 0.33
78 0.4
79 0.42
80 0.47
81 0.49
82 0.55
83 0.57
84 0.65
85 0.7
86 0.68
87 0.75
88 0.78
89 0.76
90 0.77
91 0.77
92 0.74
93 0.77
94 0.8
95 0.76
96 0.78
97 0.8
98 0.77
99 0.78
100 0.76
101 0.72
102 0.69
103 0.64
104 0.56
105 0.54
106 0.49
107 0.42
108 0.36
109 0.29
110 0.3
111 0.29
112 0.27
113 0.22
114 0.2
115 0.19
116 0.24
117 0.32
118 0.28
119 0.29
120 0.35
121 0.33
122 0.36
123 0.37
124 0.32
125 0.28
126 0.28
127 0.3
128 0.32
129 0.38
130 0.41
131 0.49
132 0.59
133 0.65
134 0.67
135 0.69
136 0.7
137 0.74
138 0.78
139 0.8
140 0.78
141 0.77
142 0.78
143 0.8
144 0.79
145 0.72
146 0.67
147 0.63
148 0.65
149 0.66
150 0.67
151 0.68
152 0.63
153 0.67
154 0.68
155 0.72
156 0.62
157 0.55
158 0.51
159 0.47