Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Z1HPC0

Protein Details
Accession A0A4Z1HPC0   
Localization Confidence Medium
Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
66-95MRRKLQNRLNQRASRQRRKADSRKLQAITKHydrophilic
NLS Segment(s)
PositionSequence
82-84RRK
Subcellular Location(s) nucl 14.5, cyto_nucl 9.5, mito 9
Family & Domain DBs
Amino Acid Sequences MFLTSLALLASDYATKPIPPQSVNMSSPMIEASCIEIPRIEILPMKQRSQIQNLEEDWTGTSSTVMRRKLQNRLNQRASRQRRKADSRKLQAITKVVE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.1
3 0.12
4 0.17
5 0.21
6 0.2
7 0.23
8 0.28
9 0.33
10 0.34
11 0.35
12 0.3
13 0.26
14 0.25
15 0.23
16 0.16
17 0.1
18 0.09
19 0.1
20 0.11
21 0.11
22 0.11
23 0.1
24 0.11
25 0.12
26 0.12
27 0.1
28 0.09
29 0.1
30 0.19
31 0.22
32 0.22
33 0.24
34 0.28
35 0.3
36 0.33
37 0.36
38 0.28
39 0.3
40 0.29
41 0.28
42 0.24
43 0.22
44 0.17
45 0.13
46 0.12
47 0.08
48 0.08
49 0.07
50 0.13
51 0.18
52 0.21
53 0.24
54 0.32
55 0.37
56 0.46
57 0.52
58 0.56
59 0.61
60 0.68
61 0.74
62 0.72
63 0.75
64 0.76
65 0.8
66 0.82
67 0.8
68 0.79
69 0.8
70 0.85
71 0.87
72 0.88
73 0.88
74 0.86
75 0.87
76 0.82
77 0.77
78 0.72