Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Z1J305

Protein Details
Accession A0A4Z1J305    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
2-28AKSKNSSQHNQSKKAHRNGIKKPKTSRHydrophilic
NLS Segment(s)
PositionSequence
14-42KKAHRNGIKKPKTSRYPSLKGTDPKFRRN
Subcellular Location(s) nucl 25, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences MAKSKNSSQHNQSKKAHRNGIKKPKTSRYPSLKGTDPKFRRNHRHALHCTMKALKELKEGKRETA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.8
3 0.8
4 0.79
5 0.8
6 0.82
7 0.85
8 0.83
9 0.8
10 0.79
11 0.79
12 0.79
13 0.76
14 0.75
15 0.73
16 0.7
17 0.67
18 0.64
19 0.6
20 0.57
21 0.54
22 0.55
23 0.5
24 0.53
25 0.56
26 0.61
27 0.65
28 0.66
29 0.72
30 0.69
31 0.75
32 0.72
33 0.74
34 0.72
35 0.64
36 0.62
37 0.55
38 0.49
39 0.45
40 0.42
41 0.35
42 0.37
43 0.43
44 0.47
45 0.52