Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Z1H8R4

Protein Details
Accession A0A4Z1H8R4    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
29-49GPRPPVQHKIKRKPVPPPTSNHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15, cyto_nucl 10.5, mito 8, cyto 4
Family & Domain DBs
Amino Acid Sequences MPQEKAHRVSEYTENIDGPTKRPPIFVFGPRPPVQHKIKRKPVPPPTSNPLTYFLPSSRKRQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.3
3 0.33
4 0.3
5 0.24
6 0.26
7 0.27
8 0.26
9 0.27
10 0.27
11 0.28
12 0.31
13 0.36
14 0.36
15 0.34
16 0.4
17 0.4
18 0.41
19 0.38
20 0.4
21 0.42
22 0.45
23 0.53
24 0.56
25 0.66
26 0.72
27 0.75
28 0.78
29 0.8
30 0.81
31 0.76
32 0.73
33 0.7
34 0.69
35 0.66
36 0.57
37 0.51
38 0.44
39 0.4
40 0.35
41 0.32
42 0.34