Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A5DU98

Protein Details
Accession A5DU98    Localization Confidence Low Confidence Score 6.9
NoLS Segment(s)
PositionSequenceProtein Nature
85-115TFNRHAKNYRKAIHRERHWCKRSFRENPKYFHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 22, nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
KEGG lel:LELG_00934  -  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFASLVRCGGYVWKFPPHITTAQRVNLKKRSLQVDSNIEAIYQGLFQVLPEKAKSGQLTNCKRVDYMKFEFPKYDEMSQRDKYFTFNRHAKNYRKAIHRERHWCKRSFRENPKYF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.32
3 0.35
4 0.32
5 0.36
6 0.34
7 0.38
8 0.37
9 0.43
10 0.5
11 0.5
12 0.54
13 0.55
14 0.55
15 0.53
16 0.53
17 0.52
18 0.5
19 0.5
20 0.49
21 0.47
22 0.45
23 0.43
24 0.36
25 0.29
26 0.24
27 0.2
28 0.13
29 0.07
30 0.05
31 0.04
32 0.04
33 0.04
34 0.07
35 0.08
36 0.09
37 0.09
38 0.1
39 0.11
40 0.14
41 0.15
42 0.14
43 0.19
44 0.27
45 0.33
46 0.38
47 0.39
48 0.36
49 0.36
50 0.36
51 0.35
52 0.33
53 0.31
54 0.33
55 0.34
56 0.35
57 0.35
58 0.33
59 0.35
60 0.31
61 0.32
62 0.29
63 0.3
64 0.36
65 0.4
66 0.4
67 0.37
68 0.33
69 0.34
70 0.35
71 0.35
72 0.37
73 0.41
74 0.45
75 0.53
76 0.61
77 0.64
78 0.67
79 0.72
80 0.71
81 0.72
82 0.75
83 0.76
84 0.79
85 0.8
86 0.82
87 0.83
88 0.86
89 0.86
90 0.84
91 0.82
92 0.82
93 0.83
94 0.83
95 0.84