Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Z1IGK9

Protein Details
Accession A0A4Z1IGK9    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
59-81MASTHRTQKRRLKTRLCKTYELSHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 8.833, nucl 8.5, cyto 8, cyto_mito 7.333, mito 5.5, extr 2, pero 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MANGWSIVIGLIIVVLASAAAWFLSPKGENQTLHGEGNRRNEPKSYTDIDNSDYVLGAMASTHRTQKRRLKTRLCKTYELSGYYSWTCMMAKENEEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.02
2 0.02
3 0.02
4 0.02
5 0.02
6 0.02
7 0.02
8 0.02
9 0.03
10 0.03
11 0.06
12 0.07
13 0.08
14 0.14
15 0.18
16 0.19
17 0.22
18 0.28
19 0.27
20 0.28
21 0.29
22 0.26
23 0.26
24 0.33
25 0.37
26 0.33
27 0.32
28 0.33
29 0.33
30 0.33
31 0.34
32 0.3
33 0.26
34 0.26
35 0.26
36 0.26
37 0.24
38 0.2
39 0.16
40 0.12
41 0.09
42 0.07
43 0.06
44 0.04
45 0.03
46 0.04
47 0.06
48 0.07
49 0.13
50 0.19
51 0.21
52 0.3
53 0.39
54 0.5
55 0.58
56 0.68
57 0.72
58 0.78
59 0.87
60 0.89
61 0.86
62 0.8
63 0.73
64 0.72
65 0.66
66 0.58
67 0.5
68 0.4
69 0.39
70 0.34
71 0.31
72 0.22
73 0.18
74 0.15
75 0.13
76 0.17
77 0.17