Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Z1H5D0

Protein Details
Accession A0A4Z1H5D0    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
47-73QYLSFNSLREKRKKKEKKKKKGVKSRSBasic
NLS Segment(s)
PositionSequence
55-73REKRKKKEKKKKKGVKSRS
Subcellular Location(s) nucl 13.5, mito 12, cyto_nucl 8
Family & Domain DBs
Amino Acid Sequences MAENGSTSTSSHHTILGLIAFAKFRSGPRKAKTTSVLPSRYTAAVAQYLSFNSLREKRKKKEKKKKKGVKSRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.16
3 0.14
4 0.11
5 0.08
6 0.08
7 0.08
8 0.07
9 0.08
10 0.08
11 0.11
12 0.18
13 0.24
14 0.31
15 0.35
16 0.43
17 0.44
18 0.48
19 0.49
20 0.47
21 0.47
22 0.46
23 0.45
24 0.38
25 0.38
26 0.34
27 0.31
28 0.26
29 0.19
30 0.13
31 0.13
32 0.12
33 0.11
34 0.1
35 0.1
36 0.11
37 0.11
38 0.11
39 0.15
40 0.22
41 0.3
42 0.4
43 0.49
44 0.56
45 0.68
46 0.78
47 0.84
48 0.88
49 0.91
50 0.92
51 0.95
52 0.96
53 0.96