Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A5E3Z8

Protein Details
Accession A5E3Z8    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MAAAGERKKSSRKKKDPDAPKRSLSHydrophilic
NLS Segment(s)
PositionSequence
7-21RKKSSRKKKDPDAPK
Subcellular Location(s) nucl 15.5, cyto_nucl 9.5, mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
KEGG lel:LELG_04337  -  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01390  HMG-box_NHP6-like  
Amino Acid Sequences MAAAGERKKSSRKKKDPDAPKRSLSAYMFFANENRDIVRAENPGITFGQVGKLLGEKWKALGSEDKVPYENKAEADKKRYEKEKAEYAKKNSV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.91
3 0.92
4 0.93
5 0.92
6 0.87
7 0.79
8 0.72
9 0.63
10 0.58
11 0.48
12 0.4
13 0.34
14 0.29
15 0.26
16 0.23
17 0.22
18 0.19
19 0.18
20 0.15
21 0.12
22 0.11
23 0.11
24 0.12
25 0.14
26 0.13
27 0.13
28 0.14
29 0.13
30 0.14
31 0.13
32 0.12
33 0.09
34 0.08
35 0.09
36 0.07
37 0.07
38 0.06
39 0.07
40 0.07
41 0.09
42 0.11
43 0.09
44 0.1
45 0.12
46 0.12
47 0.13
48 0.18
49 0.19
50 0.26
51 0.28
52 0.28
53 0.28
54 0.29
55 0.29
56 0.28
57 0.26
58 0.2
59 0.26
60 0.31
61 0.35
62 0.41
63 0.47
64 0.5
65 0.56
66 0.62
67 0.61
68 0.63
69 0.64
70 0.68
71 0.7
72 0.73
73 0.74