Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Z1HFI6

Protein Details
Accession A0A4Z1HFI6    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
57-80DIPGEKMKKKVQKYLKRKRELEDMBasic
NLS Segment(s)
PositionSequence
54-75KKKDIPGEKMKKKVQKYLKRKR
Subcellular Location(s) nucl 18.5, mito_nucl 12.666, cyto_nucl 11.833, mito 5.5
Family & Domain DBs
Amino Acid Sequences MSRYSSSETDDSQPPSITLSAALSFDEDKLPNSSDSEGYDADDEDTGTARAYVKKKDIPGEKMKKKVQKYLKRKRELEDMPKGRSESVYSMVENGSAENQGTLNQKPPNSASGDRTEQYQATHYGVAVKADRRWSGVVDGRSIPHSSLNEASPNRAMIEPVFLEQMKGGRQVYSSIPDGRIPEGKNGFETAQFASETGEYDIASNSASSMDRHEYIPKSAPITIPKPADFLKRFPQSILHHDDVAPVRARHGWGQANSRTNRISPGRPSRVDASLFGHELELKPTPRTMTEGLGATKILYETLEDVSLKRKKT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.28
3 0.25
4 0.2
5 0.16
6 0.15
7 0.13
8 0.13
9 0.13
10 0.12
11 0.12
12 0.13
13 0.16
14 0.14
15 0.14
16 0.17
17 0.19
18 0.18
19 0.2
20 0.21
21 0.19
22 0.2
23 0.21
24 0.18
25 0.17
26 0.17
27 0.16
28 0.14
29 0.13
30 0.12
31 0.09
32 0.09
33 0.08
34 0.08
35 0.08
36 0.1
37 0.16
38 0.2
39 0.25
40 0.31
41 0.36
42 0.41
43 0.48
44 0.54
45 0.56
46 0.63
47 0.68
48 0.69
49 0.73
50 0.77
51 0.77
52 0.74
53 0.76
54 0.76
55 0.75
56 0.79
57 0.81
58 0.84
59 0.86
60 0.85
61 0.8
62 0.8
63 0.78
64 0.76
65 0.76
66 0.71
67 0.64
68 0.62
69 0.58
70 0.48
71 0.4
72 0.32
73 0.24
74 0.22
75 0.21
76 0.18
77 0.19
78 0.18
79 0.18
80 0.15
81 0.12
82 0.09
83 0.07
84 0.07
85 0.06
86 0.06
87 0.09
88 0.12
89 0.12
90 0.17
91 0.2
92 0.21
93 0.22
94 0.24
95 0.23
96 0.26
97 0.27
98 0.25
99 0.27
100 0.3
101 0.28
102 0.29
103 0.28
104 0.24
105 0.22
106 0.21
107 0.17
108 0.15
109 0.15
110 0.13
111 0.13
112 0.13
113 0.14
114 0.14
115 0.14
116 0.14
117 0.17
118 0.18
119 0.17
120 0.17
121 0.17
122 0.19
123 0.22
124 0.21
125 0.2
126 0.2
127 0.19
128 0.2
129 0.2
130 0.16
131 0.14
132 0.13
133 0.12
134 0.13
135 0.13
136 0.17
137 0.17
138 0.18
139 0.15
140 0.15
141 0.15
142 0.13
143 0.12
144 0.07
145 0.09
146 0.08
147 0.08
148 0.09
149 0.08
150 0.08
151 0.08
152 0.09
153 0.08
154 0.1
155 0.1
156 0.09
157 0.09
158 0.11
159 0.12
160 0.14
161 0.15
162 0.15
163 0.15
164 0.17
165 0.17
166 0.17
167 0.2
168 0.18
169 0.22
170 0.23
171 0.22
172 0.21
173 0.22
174 0.21
175 0.17
176 0.17
177 0.12
178 0.11
179 0.11
180 0.1
181 0.09
182 0.09
183 0.09
184 0.08
185 0.08
186 0.07
187 0.07
188 0.07
189 0.07
190 0.06
191 0.05
192 0.05
193 0.06
194 0.06
195 0.06
196 0.09
197 0.12
198 0.13
199 0.14
200 0.19
201 0.2
202 0.22
203 0.27
204 0.25
205 0.25
206 0.25
207 0.27
208 0.27
209 0.28
210 0.31
211 0.3
212 0.29
213 0.29
214 0.3
215 0.36
216 0.33
217 0.35
218 0.39
219 0.42
220 0.42
221 0.4
222 0.46
223 0.41
224 0.46
225 0.49
226 0.41
227 0.36
228 0.36
229 0.4
230 0.34
231 0.33
232 0.3
233 0.22
234 0.22
235 0.23
236 0.25
237 0.23
238 0.27
239 0.3
240 0.3
241 0.38
242 0.43
243 0.5
244 0.49
245 0.51
246 0.46
247 0.41
248 0.44
249 0.41
250 0.41
251 0.43
252 0.52
253 0.56
254 0.56
255 0.6
256 0.57
257 0.56
258 0.51
259 0.44
260 0.38
261 0.33
262 0.32
263 0.28
264 0.24
265 0.21
266 0.19
267 0.21
268 0.21
269 0.19
270 0.2
271 0.22
272 0.23
273 0.23
274 0.28
275 0.27
276 0.25
277 0.27
278 0.29
279 0.28
280 0.27
281 0.26
282 0.2
283 0.19
284 0.16
285 0.12
286 0.09
287 0.09
288 0.1
289 0.11
290 0.13
291 0.13
292 0.14
293 0.23