Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Z1JG97

Protein Details
Accession A0A4Z1JG97   
Localization Confidence Medium
Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
96-115IARGSKPRSSKSHRPDHKSSBasic
NLS Segment(s)
PositionSequence
78-88AKKESDKQLKR
97-111ARGSKPRSSKSHRPD
Subcellular Location(s) nucl 13.5, cyto_nucl 12.5, mito 8, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MSSQLNRYWIPNLDINKRVITKEIQYYLGPESTLRPYTRDGEDGYLISTPGECLTDEQIDDICIKSKELWEKQAAARAKKESDKQLKRPLLQPVVIARGSKPRSSKSHRPDHKSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.41
3 0.42
4 0.41
5 0.38
6 0.35
7 0.33
8 0.31
9 0.33
10 0.34
11 0.31
12 0.29
13 0.3
14 0.29
15 0.26
16 0.22
17 0.15
18 0.15
19 0.17
20 0.21
21 0.19
22 0.19
23 0.21
24 0.24
25 0.26
26 0.25
27 0.22
28 0.2
29 0.21
30 0.19
31 0.17
32 0.13
33 0.11
34 0.09
35 0.08
36 0.06
37 0.05
38 0.05
39 0.05
40 0.05
41 0.07
42 0.08
43 0.08
44 0.08
45 0.07
46 0.07
47 0.08
48 0.07
49 0.08
50 0.07
51 0.08
52 0.08
53 0.12
54 0.19
55 0.22
56 0.26
57 0.26
58 0.29
59 0.3
60 0.37
61 0.38
62 0.33
63 0.35
64 0.34
65 0.36
66 0.38
67 0.42
68 0.46
69 0.52
70 0.58
71 0.62
72 0.69
73 0.72
74 0.7
75 0.7
76 0.69
77 0.63
78 0.55
79 0.5
80 0.43
81 0.41
82 0.39
83 0.34
84 0.27
85 0.31
86 0.33
87 0.35
88 0.36
89 0.38
90 0.47
91 0.56
92 0.65
93 0.65
94 0.73
95 0.78