Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Z1I3T0

Protein Details
Accession A0A4Z1I3T0   
Localization Confidence Low
Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
544-571FTEGEVKPTRSQKKKKRSSADDVENASTHydrophilic
NLS Segment(s)
PositionSequence
555-560QKKKKR
Subcellular Location(s) cyto 15.5, cyto_mito 10, nucl 5, mito 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR043519  NT_sf  
IPR011068  NuclTrfase_I-like_C  
IPR007012  PolA_pol_cen_dom  
IPR007010  PolA_pol_RNA-bd_dom  
IPR014492  PolyA_polymerase  
IPR002934  Polymerase_NTP_transf_dom  
Gene Ontology GO:0005634  C:nucleus  
GO:0005524  F:ATP binding  
GO:0046872  F:metal ion binding  
GO:1990817  F:poly(A) RNA polymerase activity  
GO:0003723  F:RNA binding  
GO:0006397  P:mRNA processing  
GO:0031123  P:RNA 3'-end processing  
GO:0043631  P:RNA polyadenylation  
Pfam View protein in Pfam  
PF01909  NTP_transf_2  
PF04928  PAP_central  
PF04926  PAP_RNA-bind  
CDD cd05402  NT_PAP_TUTase  
Amino Acid Sequences MAAAAPRQLGITPPLSTALPTDAEKQATDALIEEMTKENLFESRADTEKRSTVLASLQSITEEFVKRVCRKQNLPENIVNNAGGRIFTYGSFRLGVYGPGSDIDTLVVVPKNVSREEYFELFPDLLVELAPEGAITDLTPVPDAFVPIIKFEYSGISIDLIFARIEVLSQISRSLSLNDDNLLAGLDEAGLRSLNGTRVTDDILNLVPEKAVFRTALRGVKLWAQRRAIYANIMGFPGGVAWAMLVARVCQLYPQATASTVILKFFRIMSQWQWPQPVLLQAIKGGKLNVRVWNPRVYKGDGYHLMPIITPSYPSMCATHNITKSTKEIICRELARGGNITDRIMMGKASWKDLFVKHTFFTKNYKYYLSVISASTTTAAQLIWAGLVESKVRLLVSNVENHESIALAHPFNKGFERVHKCSSEDEIEAVKEGNLQYQIKEIPAVTTDPSHDTDLGIAVKDQTGQVKDENGDAPKSDSEKKESLVYTTTFYIGLELREGAKSLDLAWCVDEFKRVCRGWEKYNEELMTLSVVNTRNCDLPDDVFTEGEVKPTRSQKKKKRSSADDVENASTKRRQVVAAG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.19
3 0.19
4 0.19
5 0.17
6 0.17
7 0.17
8 0.21
9 0.23
10 0.25
11 0.24
12 0.24
13 0.24
14 0.21
15 0.2
16 0.16
17 0.14
18 0.13
19 0.13
20 0.13
21 0.12
22 0.14
23 0.14
24 0.13
25 0.12
26 0.13
27 0.15
28 0.14
29 0.16
30 0.19
31 0.24
32 0.27
33 0.29
34 0.32
35 0.34
36 0.34
37 0.32
38 0.28
39 0.24
40 0.26
41 0.27
42 0.25
43 0.23
44 0.22
45 0.21
46 0.2
47 0.2
48 0.19
49 0.18
50 0.15
51 0.18
52 0.27
53 0.31
54 0.39
55 0.47
56 0.51
57 0.56
58 0.66
59 0.73
60 0.73
61 0.75
62 0.74
63 0.68
64 0.62
65 0.56
66 0.46
67 0.36
68 0.28
69 0.21
70 0.14
71 0.12
72 0.11
73 0.1
74 0.1
75 0.14
76 0.14
77 0.15
78 0.16
79 0.16
80 0.16
81 0.16
82 0.16
83 0.13
84 0.12
85 0.11
86 0.11
87 0.12
88 0.1
89 0.09
90 0.08
91 0.07
92 0.07
93 0.09
94 0.09
95 0.08
96 0.09
97 0.11
98 0.14
99 0.15
100 0.18
101 0.17
102 0.21
103 0.25
104 0.28
105 0.26
106 0.24
107 0.25
108 0.22
109 0.2
110 0.16
111 0.12
112 0.08
113 0.08
114 0.07
115 0.04
116 0.04
117 0.04
118 0.03
119 0.03
120 0.03
121 0.04
122 0.03
123 0.06
124 0.06
125 0.07
126 0.08
127 0.08
128 0.09
129 0.09
130 0.1
131 0.08
132 0.11
133 0.11
134 0.11
135 0.13
136 0.11
137 0.11
138 0.11
139 0.13
140 0.11
141 0.11
142 0.1
143 0.09
144 0.09
145 0.1
146 0.1
147 0.08
148 0.07
149 0.06
150 0.06
151 0.05
152 0.06
153 0.05
154 0.07
155 0.06
156 0.07
157 0.08
158 0.08
159 0.09
160 0.1
161 0.11
162 0.11
163 0.12
164 0.13
165 0.13
166 0.13
167 0.12
168 0.11
169 0.1
170 0.07
171 0.05
172 0.04
173 0.04
174 0.03
175 0.03
176 0.04
177 0.04
178 0.03
179 0.04
180 0.06
181 0.08
182 0.1
183 0.11
184 0.11
185 0.12
186 0.14
187 0.14
188 0.13
189 0.12
190 0.1
191 0.1
192 0.1
193 0.09
194 0.07
195 0.07
196 0.08
197 0.07
198 0.08
199 0.08
200 0.08
201 0.12
202 0.17
203 0.2
204 0.2
205 0.2
206 0.2
207 0.26
208 0.32
209 0.34
210 0.36
211 0.35
212 0.35
213 0.37
214 0.38
215 0.32
216 0.27
217 0.23
218 0.18
219 0.16
220 0.15
221 0.12
222 0.1
223 0.09
224 0.07
225 0.05
226 0.03
227 0.02
228 0.02
229 0.03
230 0.03
231 0.03
232 0.03
233 0.03
234 0.04
235 0.05
236 0.05
237 0.05
238 0.06
239 0.07
240 0.08
241 0.09
242 0.09
243 0.09
244 0.1
245 0.1
246 0.12
247 0.11
248 0.11
249 0.1
250 0.1
251 0.11
252 0.1
253 0.11
254 0.08
255 0.1
256 0.12
257 0.2
258 0.23
259 0.24
260 0.26
261 0.25
262 0.24
263 0.23
264 0.23
265 0.17
266 0.14
267 0.12
268 0.13
269 0.14
270 0.15
271 0.14
272 0.12
273 0.12
274 0.15
275 0.17
276 0.2
277 0.24
278 0.27
279 0.28
280 0.36
281 0.36
282 0.37
283 0.37
284 0.35
285 0.33
286 0.31
287 0.34
288 0.27
289 0.27
290 0.24
291 0.21
292 0.18
293 0.16
294 0.15
295 0.11
296 0.09
297 0.08
298 0.06
299 0.07
300 0.08
301 0.09
302 0.1
303 0.1
304 0.12
305 0.16
306 0.22
307 0.23
308 0.25
309 0.26
310 0.26
311 0.26
312 0.3
313 0.27
314 0.25
315 0.25
316 0.24
317 0.27
318 0.27
319 0.26
320 0.26
321 0.25
322 0.22
323 0.21
324 0.19
325 0.18
326 0.17
327 0.16
328 0.12
329 0.11
330 0.11
331 0.1
332 0.09
333 0.06
334 0.12
335 0.12
336 0.15
337 0.15
338 0.16
339 0.18
340 0.2
341 0.26
342 0.22
343 0.24
344 0.22
345 0.27
346 0.28
347 0.28
348 0.33
349 0.33
350 0.34
351 0.34
352 0.35
353 0.31
354 0.32
355 0.33
356 0.28
357 0.23
358 0.2
359 0.19
360 0.17
361 0.15
362 0.13
363 0.1
364 0.08
365 0.06
366 0.06
367 0.05
368 0.05
369 0.05
370 0.04
371 0.04
372 0.04
373 0.04
374 0.05
375 0.05
376 0.05
377 0.05
378 0.06
379 0.06
380 0.06
381 0.07
382 0.13
383 0.14
384 0.2
385 0.22
386 0.23
387 0.23
388 0.23
389 0.22
390 0.16
391 0.14
392 0.12
393 0.12
394 0.1
395 0.12
396 0.14
397 0.14
398 0.15
399 0.17
400 0.16
401 0.16
402 0.25
403 0.33
404 0.36
405 0.41
406 0.41
407 0.41
408 0.41
409 0.43
410 0.37
411 0.29
412 0.26
413 0.22
414 0.21
415 0.19
416 0.17
417 0.12
418 0.12
419 0.11
420 0.12
421 0.15
422 0.15
423 0.15
424 0.18
425 0.19
426 0.17
427 0.18
428 0.15
429 0.12
430 0.13
431 0.14
432 0.12
433 0.12
434 0.14
435 0.15
436 0.18
437 0.18
438 0.17
439 0.16
440 0.15
441 0.16
442 0.15
443 0.12
444 0.1
445 0.09
446 0.09
447 0.1
448 0.11
449 0.13
450 0.14
451 0.15
452 0.16
453 0.19
454 0.19
455 0.21
456 0.24
457 0.22
458 0.21
459 0.2
460 0.21
461 0.21
462 0.25
463 0.28
464 0.28
465 0.32
466 0.34
467 0.35
468 0.38
469 0.36
470 0.34
471 0.32
472 0.3
473 0.26
474 0.25
475 0.24
476 0.18
477 0.17
478 0.16
479 0.13
480 0.13
481 0.11
482 0.11
483 0.12
484 0.12
485 0.13
486 0.11
487 0.11
488 0.1
489 0.1
490 0.13
491 0.12
492 0.13
493 0.13
494 0.14
495 0.15
496 0.15
497 0.21
498 0.18
499 0.22
500 0.3
501 0.29
502 0.33
503 0.4
504 0.46
505 0.48
506 0.57
507 0.61
508 0.58
509 0.65
510 0.6
511 0.52
512 0.47
513 0.38
514 0.3
515 0.23
516 0.17
517 0.15
518 0.18
519 0.18
520 0.2
521 0.22
522 0.22
523 0.23
524 0.26
525 0.23
526 0.23
527 0.25
528 0.25
529 0.25
530 0.22
531 0.21
532 0.21
533 0.18
534 0.22
535 0.21
536 0.22
537 0.27
538 0.37
539 0.47
540 0.55
541 0.66
542 0.71
543 0.79
544 0.87
545 0.91
546 0.93
547 0.92
548 0.91
549 0.91
550 0.9
551 0.87
552 0.8
553 0.74
554 0.68
555 0.59
556 0.54
557 0.47
558 0.39
559 0.37
560 0.35