Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Z1JAC3

Protein Details
Accession A0A4Z1JAC3    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
27-46KQDCTQKPPRGRCPNFKPKTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15, cyto 4, pero 4, cyto_pero 4
Family & Domain DBs
Amino Acid Sequences MCTRYQYTGRCWCDGRTGQVRVIESVKQDCTQKPPRGRCPNFKPKTFENEKCYGCIQAAAVAAAAEAATEAEAARILWGMRNGRW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.47
3 0.45
4 0.44
5 0.43
6 0.44
7 0.44
8 0.37
9 0.36
10 0.29
11 0.24
12 0.24
13 0.23
14 0.21
15 0.23
16 0.23
17 0.29
18 0.37
19 0.42
20 0.48
21 0.54
22 0.63
23 0.71
24 0.75
25 0.77
26 0.77
27 0.8
28 0.78
29 0.74
30 0.68
31 0.6
32 0.64
33 0.62
34 0.59
35 0.54
36 0.55
37 0.51
38 0.48
39 0.46
40 0.37
41 0.29
42 0.23
43 0.16
44 0.12
45 0.11
46 0.09
47 0.08
48 0.07
49 0.07
50 0.06
51 0.05
52 0.03
53 0.02
54 0.02
55 0.02
56 0.03
57 0.03
58 0.03
59 0.04
60 0.04
61 0.04
62 0.05
63 0.06
64 0.09
65 0.15