Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Z1IF27

Protein Details
Accession A0A4Z1IF27    Localization Confidence Low Confidence Score 5.4
NoLS Segment(s)
PositionSequenceProtein Nature
201-223EMENRELKRQLRKRKDGVEDLENHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 20, mito 4, nucl 1, cyto 1, cyto_nucl 1, vacu 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR031846  Hvcn1  
IPR005821  Ion_trans_dom  
IPR027359  Volt_channel_dom_sf  
Gene Ontology GO:0005886  C:plasma membrane  
GO:0030171  F:voltage-gated proton channel activity  
Pfam View protein in Pfam  
PF00520  Ion_trans  
Amino Acid Sequences MSRRNSDISEHAPLIRASSQPISIASGPSYHHVPHPSFFRKLSNSYRRSQNSAKSFLSSRAQHYTVLLLVACDLISIISDIIINLYQCDNDKEGKTDPIWNEVRDGLGIAGLIFSCLFMVELIASVWAFGLSYFRSKFHCFDATVIVAGFVVDVLLHGVLEEVASLVIILRLWRFFKIIEEFSVGAQEQMDGLEERIEQLEMENRELKRQLRKRKDGVEDLENGEGGLESDN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.27
3 0.23
4 0.2
5 0.21
6 0.21
7 0.2
8 0.21
9 0.22
10 0.2
11 0.21
12 0.17
13 0.17
14 0.17
15 0.18
16 0.2
17 0.17
18 0.2
19 0.24
20 0.26
21 0.28
22 0.36
23 0.39
24 0.4
25 0.41
26 0.43
27 0.43
28 0.48
29 0.54
30 0.56
31 0.55
32 0.58
33 0.66
34 0.63
35 0.66
36 0.65
37 0.64
38 0.6
39 0.62
40 0.56
41 0.5
42 0.47
43 0.44
44 0.45
45 0.38
46 0.36
47 0.35
48 0.35
49 0.32
50 0.31
51 0.28
52 0.21
53 0.19
54 0.14
55 0.08
56 0.07
57 0.07
58 0.06
59 0.04
60 0.04
61 0.03
62 0.03
63 0.03
64 0.03
65 0.03
66 0.03
67 0.03
68 0.04
69 0.05
70 0.05
71 0.05
72 0.06
73 0.06
74 0.07
75 0.09
76 0.1
77 0.12
78 0.13
79 0.15
80 0.16
81 0.18
82 0.19
83 0.22
84 0.21
85 0.26
86 0.27
87 0.25
88 0.24
89 0.22
90 0.21
91 0.16
92 0.15
93 0.07
94 0.06
95 0.05
96 0.04
97 0.03
98 0.03
99 0.03
100 0.03
101 0.03
102 0.02
103 0.02
104 0.03
105 0.02
106 0.03
107 0.02
108 0.03
109 0.03
110 0.03
111 0.03
112 0.03
113 0.03
114 0.03
115 0.03
116 0.02
117 0.04
118 0.04
119 0.08
120 0.09
121 0.1
122 0.14
123 0.17
124 0.18
125 0.21
126 0.24
127 0.21
128 0.22
129 0.24
130 0.21
131 0.19
132 0.17
133 0.13
134 0.09
135 0.08
136 0.07
137 0.03
138 0.03
139 0.02
140 0.02
141 0.02
142 0.02
143 0.02
144 0.02
145 0.03
146 0.03
147 0.03
148 0.03
149 0.02
150 0.02
151 0.02
152 0.02
153 0.02
154 0.03
155 0.03
156 0.04
157 0.05
158 0.07
159 0.09
160 0.1
161 0.11
162 0.11
163 0.16
164 0.21
165 0.22
166 0.22
167 0.24
168 0.24
169 0.23
170 0.24
171 0.19
172 0.14
173 0.12
174 0.1
175 0.07
176 0.06
177 0.08
178 0.06
179 0.07
180 0.08
181 0.08
182 0.09
183 0.09
184 0.09
185 0.08
186 0.09
187 0.15
188 0.16
189 0.2
190 0.25
191 0.25
192 0.29
193 0.34
194 0.38
195 0.43
196 0.51
197 0.58
198 0.63
199 0.73
200 0.77
201 0.82
202 0.86
203 0.84
204 0.8
205 0.75
206 0.69
207 0.62
208 0.54
209 0.44
210 0.35
211 0.26
212 0.19