Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Z1I2Z1

Protein Details
Accession A0A4Z1I2Z1    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
22-49RYLYARKRSLRILKKKKSYHKAANNFDSHydrophilic
NLS Segment(s)
PositionSequence
27-39RKRSLRILKKKKS
Subcellular Location(s) nucl 16.5, mito_nucl 13.166, cyto_nucl 10.333, mito 8.5
Family & Domain DBs
Amino Acid Sequences MTTKRSDSSAWSKLHAYIAQKRYLYARKRSLRILKKKKSYHKAANNFDSTPSEFGKLKQNNQCWVDRYALSQRPVDIILDPTDPSNLQTIYYNMNLASKTPALVVVASRSCLAI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.37
3 0.35
4 0.37
5 0.4
6 0.43
7 0.41
8 0.4
9 0.43
10 0.49
11 0.5
12 0.49
13 0.55
14 0.57
15 0.61
16 0.69
17 0.72
18 0.74
19 0.77
20 0.79
21 0.79
22 0.81
23 0.86
24 0.88
25 0.87
26 0.86
27 0.85
28 0.84
29 0.85
30 0.82
31 0.79
32 0.72
33 0.62
34 0.54
35 0.46
36 0.36
37 0.29
38 0.22
39 0.17
40 0.15
41 0.16
42 0.24
43 0.25
44 0.31
45 0.36
46 0.39
47 0.43
48 0.45
49 0.46
50 0.39
51 0.38
52 0.34
53 0.27
54 0.27
55 0.28
56 0.3
57 0.3
58 0.28
59 0.26
60 0.25
61 0.25
62 0.22
63 0.16
64 0.13
65 0.12
66 0.12
67 0.12
68 0.11
69 0.12
70 0.11
71 0.11
72 0.12
73 0.11
74 0.1
75 0.12
76 0.13
77 0.15
78 0.16
79 0.16
80 0.13
81 0.15
82 0.15
83 0.14
84 0.16
85 0.13
86 0.13
87 0.13
88 0.13
89 0.12
90 0.13
91 0.13
92 0.15
93 0.16
94 0.17