Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Z1HFR4

Protein Details
Accession A0A4Z1HFR4    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
88-113ESGPEAAKRRRERKMEKEAKMAKKALBasic
NLS Segment(s)
PositionSequence
94-113AKRRRERKMEKEAKMAKKAL
Subcellular Location(s) mito 7plas 7, extr 4, mito_nucl 4, E.R. 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR006694  Fatty_acid_hydroxylase  
Gene Ontology GO:0016020  C:membrane  
GO:0005506  F:iron ion binding  
GO:0016491  F:oxidoreductase activity  
GO:0044255  P:cellular lipid metabolic process  
GO:0008610  P:lipid biosynthetic process  
Pfam View protein in Pfam  
PF04116  FA_hydroxylase  
Amino Acid Sequences MVLGLGTVGSPILWVMLTGNLHILTMYIWIVCRLFQAIDAHSGYEFPWSLHHFLPFWAGAEHHDTHHEKFIGNYASSFRWWDYVLDTESGPEAAKRRRERKMEKEAKMAKKAL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.04
3 0.08
4 0.08
5 0.08
6 0.1
7 0.09
8 0.1
9 0.09
10 0.09
11 0.06
12 0.06
13 0.06
14 0.05
15 0.05
16 0.06
17 0.07
18 0.07
19 0.07
20 0.07
21 0.07
22 0.09
23 0.11
24 0.11
25 0.14
26 0.14
27 0.14
28 0.13
29 0.13
30 0.11
31 0.1
32 0.1
33 0.06
34 0.09
35 0.11
36 0.13
37 0.14
38 0.15
39 0.13
40 0.13
41 0.15
42 0.12
43 0.11
44 0.08
45 0.08
46 0.08
47 0.12
48 0.13
49 0.11
50 0.16
51 0.17
52 0.18
53 0.22
54 0.21
55 0.17
56 0.17
57 0.22
58 0.2
59 0.18
60 0.18
61 0.16
62 0.16
63 0.17
64 0.18
65 0.13
66 0.12
67 0.13
68 0.13
69 0.13
70 0.16
71 0.16
72 0.16
73 0.16
74 0.14
75 0.14
76 0.14
77 0.12
78 0.1
79 0.15
80 0.2
81 0.3
82 0.39
83 0.47
84 0.56
85 0.67
86 0.75
87 0.8
88 0.85
89 0.86
90 0.82
91 0.85
92 0.85
93 0.84