Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Z1IX99

Protein Details
Accession A0A4Z1IX99    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
11-33LESIESLKRKYKRQNRDIASVNSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22, cyto_nucl 14.5, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR011516  Shugoshin_N  
Gene Ontology GO:0000775  C:chromosome, centromeric region  
GO:0007049  P:cell cycle  
GO:0051301  P:cell division  
Pfam View protein in Pfam  
PF07558  Shugoshin_N  
Amino Acid Sequences MARLNEPAASLESIESLKRKYKRQNRDIASVNSSQAVRIRSLENETSKLLAENLELREENLRLRSEIDNGKARRAADRVNVVKSQLEERLLEIGALISGLGEESPERKRSPHVTRQFVGLRAGSNPPRSPKENKWDNLDPLNEDGTSPERKMPPRKKMASSSEDIGSPDGKLPPILENKYYPRKTLEHQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.16
3 0.17
4 0.25
5 0.3
6 0.39
7 0.48
8 0.58
9 0.67
10 0.74
11 0.81
12 0.79
13 0.82
14 0.8
15 0.74
16 0.69
17 0.6
18 0.51
19 0.43
20 0.36
21 0.29
22 0.25
23 0.22
24 0.18
25 0.18
26 0.19
27 0.19
28 0.24
29 0.28
30 0.27
31 0.28
32 0.28
33 0.26
34 0.25
35 0.23
36 0.18
37 0.13
38 0.11
39 0.13
40 0.13
41 0.14
42 0.14
43 0.14
44 0.16
45 0.16
46 0.17
47 0.16
48 0.16
49 0.14
50 0.17
51 0.18
52 0.2
53 0.23
54 0.25
55 0.3
56 0.3
57 0.32
58 0.32
59 0.31
60 0.3
61 0.28
62 0.27
63 0.23
64 0.31
65 0.31
66 0.32
67 0.32
68 0.29
69 0.28
70 0.26
71 0.24
72 0.17
73 0.15
74 0.12
75 0.12
76 0.13
77 0.12
78 0.1
79 0.08
80 0.06
81 0.05
82 0.04
83 0.03
84 0.02
85 0.02
86 0.02
87 0.02
88 0.02
89 0.02
90 0.05
91 0.08
92 0.1
93 0.11
94 0.12
95 0.17
96 0.25
97 0.34
98 0.42
99 0.48
100 0.52
101 0.52
102 0.58
103 0.56
104 0.49
105 0.42
106 0.33
107 0.25
108 0.2
109 0.24
110 0.22
111 0.24
112 0.25
113 0.28
114 0.32
115 0.36
116 0.41
117 0.45
118 0.51
119 0.57
120 0.57
121 0.6
122 0.61
123 0.61
124 0.59
125 0.52
126 0.43
127 0.36
128 0.34
129 0.26
130 0.2
131 0.18
132 0.16
133 0.18
134 0.17
135 0.2
136 0.24
137 0.32
138 0.43
139 0.51
140 0.58
141 0.65
142 0.71
143 0.73
144 0.76
145 0.77
146 0.73
147 0.67
148 0.61
149 0.52
150 0.46
151 0.4
152 0.33
153 0.25
154 0.19
155 0.17
156 0.16
157 0.14
158 0.14
159 0.15
160 0.2
161 0.27
162 0.3
163 0.31
164 0.35
165 0.44
166 0.54
167 0.55
168 0.51
169 0.48