Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Z1I9E5

Protein Details
Accession A0A4Z1I9E5    Localization Confidence High Confidence Score 18.4
NoLS Segment(s)
PositionSequenceProtein Nature
10-29EDNSSRSTTKKPRHGFKVGPHydrophilic
172-193FERREREKKAKIEERERFRRQMBasic
NLS Segment(s)
PositionSequence
38-65RRKVIAIKKDLIHKAKVKKSYAKLKARE
134-209KDKKRERGEKRGAKPAYFAKELAFAEKQKAEQQARREEFERREREKKAKIEERERFRRQMAKARSGGKNGQRKLGR
Subcellular Location(s) nucl 23.5, cyto_nucl 13.5
Family & Domain DBs
Amino Acid Sequences MAPTKRPREEDNSSRSTTKKPRHGFKVGPDNLPDGTWRRKVIAIKKDLIHKAKVKKSYAKLKAREPLMKDERKIYADAEDKEDEVAKDEEGEDAVEGEEPAELHPQRKAMLDEPEADTATKTVPRYSNNSEDAKDKKRERGEKRGAKPAYFAKELAFAEKQKAEQQARREEFERREREKKAKIEERERFRRQMAKARSGGKNGQRKLGRESQVLLEKVKRVVGN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.57
3 0.58
4 0.59
5 0.59
6 0.61
7 0.64
8 0.7
9 0.76
10 0.82
11 0.79
12 0.79
13 0.8
14 0.74
15 0.69
16 0.61
17 0.54
18 0.46
19 0.4
20 0.33
21 0.27
22 0.29
23 0.3
24 0.29
25 0.29
26 0.33
27 0.4
28 0.47
29 0.51
30 0.51
31 0.52
32 0.54
33 0.6
34 0.63
35 0.6
36 0.57
37 0.55
38 0.58
39 0.6
40 0.64
41 0.62
42 0.63
43 0.67
44 0.71
45 0.74
46 0.74
47 0.72
48 0.72
49 0.72
50 0.7
51 0.67
52 0.6
53 0.6
54 0.59
55 0.59
56 0.53
57 0.5
58 0.47
59 0.43
60 0.41
61 0.31
62 0.28
63 0.29
64 0.29
65 0.29
66 0.26
67 0.24
68 0.24
69 0.24
70 0.18
71 0.15
72 0.14
73 0.09
74 0.09
75 0.09
76 0.09
77 0.08
78 0.08
79 0.05
80 0.04
81 0.05
82 0.04
83 0.04
84 0.04
85 0.04
86 0.04
87 0.04
88 0.08
89 0.08
90 0.09
91 0.1
92 0.11
93 0.12
94 0.13
95 0.15
96 0.13
97 0.17
98 0.18
99 0.19
100 0.2
101 0.2
102 0.19
103 0.17
104 0.14
105 0.1
106 0.1
107 0.1
108 0.09
109 0.11
110 0.14
111 0.16
112 0.22
113 0.27
114 0.32
115 0.34
116 0.36
117 0.34
118 0.36
119 0.39
120 0.39
121 0.43
122 0.4
123 0.43
124 0.5
125 0.59
126 0.62
127 0.67
128 0.71
129 0.73
130 0.76
131 0.78
132 0.72
133 0.62
134 0.58
135 0.54
136 0.48
137 0.4
138 0.35
139 0.26
140 0.29
141 0.29
142 0.29
143 0.25
144 0.2
145 0.22
146 0.23
147 0.24
148 0.23
149 0.31
150 0.33
151 0.35
152 0.41
153 0.48
154 0.5
155 0.53
156 0.51
157 0.5
158 0.52
159 0.57
160 0.59
161 0.56
162 0.6
163 0.63
164 0.7
165 0.72
166 0.72
167 0.73
168 0.72
169 0.74
170 0.78
171 0.8
172 0.81
173 0.83
174 0.81
175 0.76
176 0.72
177 0.7
178 0.66
179 0.67
180 0.65
181 0.64
182 0.65
183 0.68
184 0.67
185 0.65
186 0.67
187 0.66
188 0.67
189 0.6
190 0.63
191 0.61
192 0.59
193 0.61
194 0.62
195 0.59
196 0.52
197 0.52
198 0.51
199 0.53
200 0.52
201 0.48
202 0.42
203 0.4
204 0.39