Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Z1IXP3

Protein Details
Accession A0A4Z1IXP3    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
71-97SPPKIPSPTKKTSPKKKVGPKNGPIKAHydrophilic
NLS Segment(s)
PositionSequence
74-111KIPSPTKKTSPKKKVGPKNGPIKAAPKPRGKKGAGKKE
Subcellular Location(s) cyto 16, nucl 10.5, mito_nucl 6
Family & Domain DBs
Amino Acid Sequences MTTLTLSAKETEMLVAVMSEMGEIPSNINFDRVASRVNVKFARNARQSFKKLFEKLKDQAGPSPADEDGASPPKIPSPTKKTSPKKKVGPKNGPIKAAPKPRGKKGAGKKEVKEEEVDSGDELAEPVLDDEDGKSPEHVPSLKAEIPGKNAVVGPSTGSPESLQISDEVARISVVEAEETFSTSIEESSVDEQVDLDELLAAQSGISVAAYRQWKALNDYTFLQNS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.07
3 0.07
4 0.06
5 0.05
6 0.05
7 0.04
8 0.05
9 0.06
10 0.06
11 0.07
12 0.08
13 0.1
14 0.1
15 0.11
16 0.11
17 0.12
18 0.14
19 0.14
20 0.15
21 0.15
22 0.22
23 0.23
24 0.3
25 0.33
26 0.31
27 0.37
28 0.41
29 0.48
30 0.49
31 0.52
32 0.53
33 0.58
34 0.63
35 0.61
36 0.64
37 0.62
38 0.62
39 0.65
40 0.63
41 0.62
42 0.6
43 0.63
44 0.58
45 0.51
46 0.49
47 0.44
48 0.39
49 0.32
50 0.3
51 0.21
52 0.18
53 0.17
54 0.13
55 0.14
56 0.17
57 0.16
58 0.15
59 0.15
60 0.17
61 0.21
62 0.22
63 0.26
64 0.31
65 0.38
66 0.46
67 0.56
68 0.64
69 0.72
70 0.79
71 0.8
72 0.81
73 0.85
74 0.86
75 0.87
76 0.87
77 0.84
78 0.84
79 0.79
80 0.72
81 0.63
82 0.57
83 0.53
84 0.52
85 0.52
86 0.51
87 0.51
88 0.54
89 0.61
90 0.59
91 0.61
92 0.62
93 0.65
94 0.65
95 0.67
96 0.63
97 0.63
98 0.63
99 0.55
100 0.46
101 0.36
102 0.29
103 0.24
104 0.22
105 0.13
106 0.11
107 0.1
108 0.08
109 0.07
110 0.04
111 0.03
112 0.03
113 0.03
114 0.03
115 0.03
116 0.03
117 0.04
118 0.06
119 0.07
120 0.08
121 0.08
122 0.09
123 0.1
124 0.13
125 0.12
126 0.11
127 0.12
128 0.17
129 0.18
130 0.2
131 0.22
132 0.21
133 0.24
134 0.26
135 0.24
136 0.2
137 0.18
138 0.16
139 0.14
140 0.13
141 0.11
142 0.1
143 0.12
144 0.11
145 0.11
146 0.11
147 0.11
148 0.13
149 0.11
150 0.11
151 0.09
152 0.11
153 0.11
154 0.11
155 0.1
156 0.08
157 0.08
158 0.08
159 0.08
160 0.08
161 0.07
162 0.07
163 0.07
164 0.09
165 0.09
166 0.1
167 0.1
168 0.08
169 0.08
170 0.08
171 0.08
172 0.07
173 0.07
174 0.08
175 0.1
176 0.11
177 0.1
178 0.1
179 0.1
180 0.1
181 0.1
182 0.08
183 0.06
184 0.05
185 0.05
186 0.05
187 0.05
188 0.05
189 0.04
190 0.04
191 0.04
192 0.04
193 0.04
194 0.04
195 0.04
196 0.1
197 0.14
198 0.14
199 0.17
200 0.2
201 0.23
202 0.3
203 0.37
204 0.34
205 0.35
206 0.37