Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Z1HUR8

Protein Details
Accession A0A4Z1HUR8    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
15-44KSQTPKVEPQEKKKRPKGRAAKREKFVRRFBasic
NLS Segment(s)
PositionSequence
13-43KVKSQTPKVEPQEKKKRPKGRAAKREKFVRR
Subcellular Location(s) mito 13, nucl 7, cyto 7, cyto_nucl 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
Amino Acid Sequences MGKVHGSLARAGKVKSQTPKVEPQEKKKRPKGRAAKREKFVRRFVNVTLTGGKRKMNPNPGA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.41
3 0.46
4 0.46
5 0.48
6 0.57
7 0.59
8 0.65
9 0.64
10 0.67
11 0.71
12 0.74
13 0.8
14 0.8
15 0.82
16 0.78
17 0.82
18 0.82
19 0.82
20 0.84
21 0.85
22 0.84
23 0.82
24 0.86
25 0.84
26 0.8
27 0.77
28 0.74
29 0.68
30 0.62
31 0.56
32 0.54
33 0.46
34 0.42
35 0.4
36 0.36
37 0.35
38 0.35
39 0.36
40 0.34
41 0.41
42 0.47