Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Z1H3G1

Protein Details
Accession A0A4Z1H3G1   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
19-38IRLNKKCTYKQLQSTRRPSQHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 17, mito 6, cyto 2
Family & Domain DBs
Amino Acid Sequences MVLLGAVVLVSLTSQEKSIRLNKKCTYKQLQSTRRPSQGSGMPSPASFLEQSTDSGEGYQTVISNSSFSPLVSPPFDQGHPWSLQEPLTRSDVSWGT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.09
3 0.1
4 0.16
5 0.25
6 0.34
7 0.38
8 0.46
9 0.51
10 0.61
11 0.66
12 0.7
13 0.7
14 0.68
15 0.73
16 0.75
17 0.79
18 0.78
19 0.81
20 0.79
21 0.76
22 0.7
23 0.6
24 0.55
25 0.5
26 0.45
27 0.37
28 0.32
29 0.27
30 0.25
31 0.25
32 0.2
33 0.16
34 0.11
35 0.09
36 0.08
37 0.08
38 0.09
39 0.09
40 0.1
41 0.08
42 0.08
43 0.08
44 0.07
45 0.07
46 0.06
47 0.05
48 0.05
49 0.06
50 0.06
51 0.07
52 0.07
53 0.08
54 0.08
55 0.08
56 0.1
57 0.1
58 0.13
59 0.14
60 0.15
61 0.16
62 0.19
63 0.2
64 0.2
65 0.22
66 0.23
67 0.23
68 0.24
69 0.22
70 0.21
71 0.24
72 0.26
73 0.26
74 0.24
75 0.26
76 0.25
77 0.24