Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Z1IWA7

Protein Details
Accession A0A4Z1IWA7    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
6-33EPSSEAYRERKAKKSRSQPQAQNQQLQSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13, cyto 7, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR027843  DUF4440  
Pfam View protein in Pfam  
PF14534  DUF4440  
Amino Acid Sequences MSFILEPSSEAYRERKAKKSRSQPQAQNQQLQSQSPPAPPQNMSMQQQQQNGGQLAHNFQQNFQQAKQPETSKPRYKGGNYGPGTISQRIEKAMYELEHQTWRCRLDKPSALLEYIDPKAVFASPEYGILTNDSEPTLKETLEDDDMRTWNSYEIKDMKIVEVSMMAATVVYDVTASITDEKGYPKGIYKAYCTSCWKQEASADWKLCTYTEAPHP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.5
3 0.57
4 0.66
5 0.74
6 0.81
7 0.83
8 0.85
9 0.88
10 0.89
11 0.89
12 0.9
13 0.86
14 0.83
15 0.74
16 0.71
17 0.62
18 0.54
19 0.46
20 0.41
21 0.37
22 0.32
23 0.36
24 0.32
25 0.34
26 0.33
27 0.35
28 0.37
29 0.39
30 0.4
31 0.42
32 0.45
33 0.47
34 0.48
35 0.47
36 0.41
37 0.4
38 0.37
39 0.3
40 0.25
41 0.2
42 0.21
43 0.21
44 0.23
45 0.19
46 0.18
47 0.24
48 0.28
49 0.3
50 0.28
51 0.32
52 0.3
53 0.32
54 0.37
55 0.33
56 0.34
57 0.4
58 0.47
59 0.49
60 0.52
61 0.54
62 0.55
63 0.54
64 0.55
65 0.53
66 0.55
67 0.47
68 0.46
69 0.42
70 0.39
71 0.4
72 0.33
73 0.28
74 0.19
75 0.18
76 0.16
77 0.16
78 0.13
79 0.12
80 0.12
81 0.12
82 0.13
83 0.13
84 0.14
85 0.18
86 0.18
87 0.19
88 0.19
89 0.21
90 0.21
91 0.23
92 0.24
93 0.26
94 0.31
95 0.32
96 0.34
97 0.32
98 0.3
99 0.28
100 0.25
101 0.22
102 0.18
103 0.16
104 0.11
105 0.1
106 0.1
107 0.1
108 0.1
109 0.06
110 0.09
111 0.08
112 0.09
113 0.1
114 0.1
115 0.09
116 0.1
117 0.11
118 0.08
119 0.09
120 0.08
121 0.08
122 0.08
123 0.11
124 0.11
125 0.1
126 0.1
127 0.11
128 0.12
129 0.16
130 0.16
131 0.14
132 0.16
133 0.17
134 0.17
135 0.17
136 0.15
137 0.14
138 0.16
139 0.15
140 0.18
141 0.2
142 0.21
143 0.23
144 0.23
145 0.21
146 0.2
147 0.19
148 0.14
149 0.11
150 0.11
151 0.08
152 0.07
153 0.06
154 0.04
155 0.04
156 0.04
157 0.03
158 0.03
159 0.03
160 0.03
161 0.04
162 0.04
163 0.05
164 0.07
165 0.07
166 0.08
167 0.1
168 0.12
169 0.13
170 0.15
171 0.15
172 0.19
173 0.24
174 0.28
175 0.29
176 0.32
177 0.39
178 0.41
179 0.46
180 0.49
181 0.49
182 0.51
183 0.53
184 0.49
185 0.42
186 0.43
187 0.45
188 0.44
189 0.48
190 0.43
191 0.4
192 0.39
193 0.38
194 0.34
195 0.29
196 0.23