Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Z1IHT4

Protein Details
Accession A0A4Z1IHT4    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
250-275GKVVKGPKVQIMRRRKRQTRDLEAQSHydrophilic
NLS Segment(s)
PositionSequence
262-265RRRK
Subcellular Location(s) nucl 17.5, mito_nucl 12, mito 5.5, cyto 3
Family & Domain DBs
Amino Acid Sequences MSSITNVMRLLNNVITGEYPEYLPRSSFEVITLLGGLKSREEVYLSHYRRMKGVTNHELKRMYDFVAASIVKVTEITKELMELASIDSRVKSFYVYEVLRILYLAFGAFQSKKKTVASATWELLYPEDECDHLEIYAQALGHDFQFCFNIDTDHYYSSPGSSLRNGFEKTLSACIPPANQIPVYCHLTAQPDKPVCPQFYRNPYFYGPRNLRNQNHESNREYFRIKEDREKGMYRTKAALIDDISYNHGGKVVKGPKVQIMRRRKRQTRDLEAQS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.16
3 0.16
4 0.17
5 0.13
6 0.13
7 0.14
8 0.16
9 0.17
10 0.17
11 0.16
12 0.19
13 0.2
14 0.19
15 0.18
16 0.17
17 0.16
18 0.16
19 0.16
20 0.11
21 0.1
22 0.11
23 0.1
24 0.09
25 0.1
26 0.11
27 0.11
28 0.11
29 0.11
30 0.17
31 0.28
32 0.3
33 0.35
34 0.39
35 0.39
36 0.4
37 0.43
38 0.43
39 0.41
40 0.48
41 0.51
42 0.56
43 0.58
44 0.61
45 0.6
46 0.53
47 0.5
48 0.42
49 0.33
50 0.27
51 0.25
52 0.2
53 0.22
54 0.21
55 0.17
56 0.16
57 0.14
58 0.11
59 0.11
60 0.11
61 0.08
62 0.09
63 0.1
64 0.09
65 0.1
66 0.1
67 0.1
68 0.09
69 0.08
70 0.08
71 0.08
72 0.08
73 0.08
74 0.08
75 0.08
76 0.09
77 0.09
78 0.08
79 0.07
80 0.09
81 0.14
82 0.14
83 0.15
84 0.15
85 0.15
86 0.14
87 0.14
88 0.12
89 0.06
90 0.06
91 0.05
92 0.04
93 0.04
94 0.06
95 0.08
96 0.11
97 0.15
98 0.16
99 0.19
100 0.19
101 0.21
102 0.2
103 0.23
104 0.26
105 0.26
106 0.26
107 0.24
108 0.24
109 0.22
110 0.21
111 0.17
112 0.11
113 0.08
114 0.07
115 0.07
116 0.07
117 0.07
118 0.07
119 0.06
120 0.06
121 0.05
122 0.05
123 0.06
124 0.06
125 0.05
126 0.05
127 0.06
128 0.06
129 0.07
130 0.06
131 0.05
132 0.07
133 0.07
134 0.08
135 0.08
136 0.08
137 0.08
138 0.12
139 0.13
140 0.13
141 0.13
142 0.13
143 0.13
144 0.12
145 0.13
146 0.1
147 0.1
148 0.11
149 0.12
150 0.13
151 0.17
152 0.18
153 0.17
154 0.17
155 0.17
156 0.17
157 0.18
158 0.17
159 0.13
160 0.13
161 0.13
162 0.13
163 0.14
164 0.15
165 0.14
166 0.14
167 0.14
168 0.17
169 0.2
170 0.24
171 0.21
172 0.2
173 0.19
174 0.24
175 0.27
176 0.26
177 0.29
178 0.26
179 0.28
180 0.33
181 0.37
182 0.34
183 0.36
184 0.4
185 0.4
186 0.49
187 0.53
188 0.49
189 0.47
190 0.47
191 0.48
192 0.46
193 0.48
194 0.43
195 0.45
196 0.53
197 0.58
198 0.59
199 0.62
200 0.65
201 0.64
202 0.67
203 0.66
204 0.62
205 0.59
206 0.58
207 0.54
208 0.49
209 0.4
210 0.4
211 0.42
212 0.42
213 0.46
214 0.48
215 0.52
216 0.56
217 0.58
218 0.55
219 0.56
220 0.56
221 0.49
222 0.47
223 0.42
224 0.39
225 0.37
226 0.36
227 0.27
228 0.26
229 0.24
230 0.22
231 0.23
232 0.21
233 0.2
234 0.16
235 0.19
236 0.16
237 0.16
238 0.25
239 0.29
240 0.34
241 0.36
242 0.38
243 0.42
244 0.52
245 0.58
246 0.58
247 0.63
248 0.67
249 0.76
250 0.85
251 0.86
252 0.87
253 0.89
254 0.91
255 0.9