Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Z1I5T6

Protein Details
Accession A0A4Z1I5T6    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
89-116IIERDRQKNAAKKEKKRKRAAEEGHDGPBasic
NLS Segment(s)
PositionSequence
85-120KKKKIIERDRQKNAAKKEKKRKRAAEEGHDGPRKAG
Subcellular Location(s) cyto 17, cyto_nucl 16.833, nucl 8.5, mito_nucl 5.664
Family & Domain DBs
InterPro View protein in InterPro  
IPR029063  SAM-dependent_MTases_sf  
IPR002905  Trm1  
Gene Ontology GO:0004809  F:tRNA (guanine-N2-)-methyltransferase activity  
GO:0000049  F:tRNA binding  
Pfam View protein in Pfam  
PF02005  TRM  
PROSITE View protein in PROSITE  
PS51626  SAM_MT_TRM1  
Amino Acid Sequences MDSTLPDISVAPAADQHILHDGKEYTTVKEGLAHILIPAEGSKVPQTTPKGQNQVQSVFYNPIQQFNRDLSVLAIKAYGESILEKKKKIIERDRQKNAAKKEKKRKRAAEEGHDGPRKAGKLENAGETVELPIAVAKH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.12
3 0.13
4 0.17
5 0.17
6 0.17
7 0.19
8 0.19
9 0.17
10 0.24
11 0.24
12 0.2
13 0.23
14 0.23
15 0.2
16 0.23
17 0.23
18 0.18
19 0.18
20 0.15
21 0.12
22 0.12
23 0.11
24 0.08
25 0.07
26 0.06
27 0.06
28 0.07
29 0.08
30 0.09
31 0.1
32 0.15
33 0.19
34 0.26
35 0.33
36 0.38
37 0.43
38 0.45
39 0.49
40 0.47
41 0.45
42 0.4
43 0.34
44 0.29
45 0.25
46 0.23
47 0.26
48 0.22
49 0.26
50 0.24
51 0.24
52 0.25
53 0.23
54 0.24
55 0.17
56 0.17
57 0.11
58 0.12
59 0.11
60 0.09
61 0.08
62 0.06
63 0.06
64 0.06
65 0.05
66 0.04
67 0.05
68 0.08
69 0.15
70 0.18
71 0.18
72 0.21
73 0.27
74 0.32
75 0.4
76 0.48
77 0.51
78 0.6
79 0.7
80 0.76
81 0.78
82 0.79
83 0.78
84 0.77
85 0.77
86 0.76
87 0.76
88 0.8
89 0.82
90 0.86
91 0.89
92 0.9
93 0.87
94 0.88
95 0.86
96 0.84
97 0.82
98 0.77
99 0.76
100 0.7
101 0.62
102 0.52
103 0.48
104 0.39
105 0.33
106 0.31
107 0.27
108 0.31
109 0.34
110 0.36
111 0.33
112 0.32
113 0.31
114 0.27
115 0.23
116 0.16
117 0.12
118 0.08