Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Z1HEL8

Protein Details
Accession A0A4Z1HEL8    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-37MFPIQPRRGRQRNKKLRPICIRARIRHRQDPRPDRGSBasic
NLS Segment(s)
PositionSequence
7-35RRGRQRNKKLRPICIRARIRHRQDPRPDR
Subcellular Location(s) mito 15, nucl 7, cyto 4
Family & Domain DBs
Amino Acid Sequences MFPIQPRRGRQRNKKLRPICIRARIRHRQDPRPDRGSAAAGARGIARLQHEVGDDAVEDDVVVVAAPDESLEVGARFGRVRRVEFEGYGALGEGEVRWI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.93
2 0.9
3 0.91
4 0.9
5 0.87
6 0.85
7 0.85
8 0.83
9 0.8
10 0.82
11 0.82
12 0.8
13 0.82
14 0.8
15 0.79
16 0.81
17 0.82
18 0.8
19 0.75
20 0.67
21 0.59
22 0.52
23 0.44
24 0.35
25 0.27
26 0.2
27 0.15
28 0.14
29 0.12
30 0.11
31 0.09
32 0.08
33 0.08
34 0.08
35 0.08
36 0.09
37 0.09
38 0.09
39 0.09
40 0.08
41 0.07
42 0.06
43 0.05
44 0.04
45 0.04
46 0.03
47 0.03
48 0.03
49 0.02
50 0.02
51 0.02
52 0.02
53 0.02
54 0.02
55 0.02
56 0.03
57 0.03
58 0.04
59 0.04
60 0.05
61 0.05
62 0.07
63 0.08
64 0.09
65 0.17
66 0.2
67 0.23
68 0.26
69 0.32
70 0.34
71 0.34
72 0.35
73 0.28
74 0.25
75 0.22
76 0.18
77 0.12
78 0.09
79 0.08