Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Z1IHH9

Protein Details
Accession A0A4Z1IHH9    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
51-82KPKQDDKYKSCEKKKEKEKSKKEKKNSAGGCVBasic
NLS Segment(s)
PositionSequence
63-75KKKEKEKSKKEKK
Subcellular Location(s) nucl 19.5, mito_nucl 12, mito 3.5, cyto 2
Family & Domain DBs
Amino Acid Sequences MPADWRTDKSGNVKGFIRRKGDPNPMNWGYKVDDKVLSHPKADTIKTDVSKPKQDDKYKSCEKKKEKEKSKKEKKNSAGGCVVS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.52
3 0.53
4 0.52
5 0.47
6 0.51
7 0.55
8 0.61
9 0.57
10 0.52
11 0.55
12 0.53
13 0.52
14 0.46
15 0.4
16 0.32
17 0.33
18 0.31
19 0.24
20 0.23
21 0.22
22 0.28
23 0.34
24 0.32
25 0.28
26 0.26
27 0.28
28 0.28
29 0.27
30 0.23
31 0.18
32 0.22
33 0.22
34 0.27
35 0.3
36 0.32
37 0.38
38 0.4
39 0.45
40 0.5
41 0.57
42 0.61
43 0.59
44 0.64
45 0.68
46 0.74
47 0.74
48 0.75
49 0.76
50 0.78
51 0.84
52 0.85
53 0.86
54 0.87
55 0.9
56 0.91
57 0.94
58 0.94
59 0.94
60 0.94
61 0.9
62 0.89
63 0.83
64 0.79