Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A5E7J7

Protein Details
Accession A5E7J7   
Localization Confidence Medium
Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
159-179VEKAKREKEERHRKKLEELREBasic
NLS Segment(s)
PositionSequence
161-173KAKREKEERHRKK
Subcellular Location(s) nucl 12, mito 5, cyto 3, plas 3, golg 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR022533  Cox20  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
GO:0033617  P:mitochondrial cytochrome c oxidase assembly  
KEGG lel:LELG_05586  -  
Pfam View protein in Pfam  
PF12597  Cox20  
Amino Acid Sequences MGWFGGGSSNSQQAPPAKVSIVSEYKEEPKPHQQYLEDLPPKFADDDDDNLLQSSQSQSQTQVQPQPLSPSQQRQATLSDAAKMIKLSDFTFDRFVQMPCFREAMITGFQAMGVLGVITFLVHRNFKKSMNWSVGGFFLGNLVGWEQCRSLRRRSFEMVEKAKREKEERHRKKLEELRESQLDMDDVKRFEEFNNRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.27
3 0.27
4 0.23
5 0.24
6 0.26
7 0.28
8 0.29
9 0.26
10 0.26
11 0.28
12 0.33
13 0.37
14 0.38
15 0.37
16 0.43
17 0.48
18 0.49
19 0.51
20 0.47
21 0.45
22 0.5
23 0.54
24 0.49
25 0.43
26 0.42
27 0.37
28 0.37
29 0.32
30 0.25
31 0.19
32 0.16
33 0.19
34 0.21
35 0.21
36 0.2
37 0.19
38 0.19
39 0.14
40 0.13
41 0.12
42 0.12
43 0.13
44 0.14
45 0.16
46 0.22
47 0.26
48 0.3
49 0.33
50 0.32
51 0.31
52 0.31
53 0.35
54 0.3
55 0.32
56 0.31
57 0.32
58 0.34
59 0.36
60 0.36
61 0.31
62 0.32
63 0.29
64 0.3
65 0.24
66 0.2
67 0.17
68 0.17
69 0.15
70 0.13
71 0.11
72 0.08
73 0.09
74 0.08
75 0.11
76 0.12
77 0.12
78 0.16
79 0.15
80 0.17
81 0.17
82 0.17
83 0.18
84 0.19
85 0.19
86 0.17
87 0.18
88 0.16
89 0.14
90 0.15
91 0.13
92 0.12
93 0.1
94 0.09
95 0.08
96 0.08
97 0.08
98 0.07
99 0.05
100 0.03
101 0.03
102 0.02
103 0.02
104 0.02
105 0.02
106 0.02
107 0.04
108 0.06
109 0.1
110 0.1
111 0.15
112 0.17
113 0.2
114 0.25
115 0.3
116 0.35
117 0.37
118 0.38
119 0.35
120 0.33
121 0.32
122 0.27
123 0.21
124 0.13
125 0.09
126 0.07
127 0.06
128 0.05
129 0.05
130 0.05
131 0.06
132 0.07
133 0.07
134 0.11
135 0.17
136 0.21
137 0.3
138 0.36
139 0.41
140 0.46
141 0.51
142 0.54
143 0.57
144 0.63
145 0.63
146 0.63
147 0.64
148 0.63
149 0.62
150 0.61
151 0.58
152 0.58
153 0.6
154 0.64
155 0.69
156 0.75
157 0.79
158 0.77
159 0.82
160 0.8
161 0.79
162 0.78
163 0.72
164 0.69
165 0.64
166 0.62
167 0.52
168 0.44
169 0.35
170 0.27
171 0.24
172 0.22
173 0.18
174 0.19
175 0.19
176 0.18
177 0.2