Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Z1HWI7

Protein Details
Accession A0A4Z1HWI7   
Localization Confidence High
Confidence Score 15
NoLS Segment(s)
PositionSequenceProtein Nature
43-77SSTSTAASSKPPRKQRRHLRRKPFRDANYQNQRNMHydrophilic
324-343HHQCSNKSRARKTYELKLNLHydrophilic
NLS Segment(s)
PositionSequence
52-65KPPRKQRRHLRRKP
Subcellular Location(s) nucl 18, cyto_nucl 11, mito 7
Family & Domain DBs
Amino Acid Sequences MRVVVQALPFSNNGTDKLRRSSERIPINLPSPSTNSARSIHPSSTSTAASSKPPRKQRRHLRRKPFRDANYQNQRNMIPKTTVQDLSNGSERTGGATPTRFEDLEGAVLPGRPVTADSRPRQGTPKGPIRRPHATPVEKPAEKSGEPPEGSSLDDSLDSHPSIEKTPSRNPKEPVRDLYRPSRDLVEKSKLAEPSYGSPEGDPANNSLSPQETSSELSTIRRPNNRISPKPRTSASSRQPTTSRGTYQSSPKESQQGPQTRSPTSGIRDQSSDMEVTRKNLPPNITSPRAVPSSGIAAAVQRRMAGRNETRRRDGYSGMTQVIHHQCSNKSRARKTYELKLNL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.31
3 0.33
4 0.4
5 0.45
6 0.45
7 0.51
8 0.56
9 0.59
10 0.62
11 0.61
12 0.58
13 0.55
14 0.55
15 0.51
16 0.45
17 0.39
18 0.35
19 0.35
20 0.34
21 0.32
22 0.32
23 0.31
24 0.33
25 0.36
26 0.36
27 0.34
28 0.34
29 0.33
30 0.32
31 0.33
32 0.3
33 0.25
34 0.23
35 0.23
36 0.27
37 0.35
38 0.41
39 0.46
40 0.56
41 0.65
42 0.73
43 0.83
44 0.86
45 0.88
46 0.91
47 0.93
48 0.94
49 0.94
50 0.94
51 0.94
52 0.93
53 0.88
54 0.88
55 0.85
56 0.84
57 0.85
58 0.8
59 0.71
60 0.65
61 0.6
62 0.55
63 0.5
64 0.43
65 0.35
66 0.32
67 0.33
68 0.34
69 0.35
70 0.29
71 0.3
72 0.29
73 0.29
74 0.32
75 0.29
76 0.24
77 0.23
78 0.22
79 0.22
80 0.2
81 0.18
82 0.14
83 0.16
84 0.17
85 0.18
86 0.2
87 0.17
88 0.16
89 0.16
90 0.15
91 0.14
92 0.14
93 0.11
94 0.1
95 0.1
96 0.09
97 0.08
98 0.07
99 0.05
100 0.06
101 0.09
102 0.16
103 0.24
104 0.27
105 0.35
106 0.36
107 0.38
108 0.42
109 0.42
110 0.42
111 0.42
112 0.5
113 0.5
114 0.55
115 0.6
116 0.62
117 0.65
118 0.61
119 0.6
120 0.6
121 0.57
122 0.53
123 0.54
124 0.56
125 0.5
126 0.47
127 0.43
128 0.37
129 0.32
130 0.32
131 0.29
132 0.26
133 0.26
134 0.25
135 0.24
136 0.21
137 0.21
138 0.18
139 0.14
140 0.08
141 0.08
142 0.08
143 0.08
144 0.09
145 0.08
146 0.08
147 0.09
148 0.09
149 0.1
150 0.13
151 0.15
152 0.18
153 0.27
154 0.36
155 0.42
156 0.47
157 0.49
158 0.55
159 0.6
160 0.59
161 0.57
162 0.55
163 0.52
164 0.51
165 0.56
166 0.53
167 0.46
168 0.43
169 0.4
170 0.35
171 0.34
172 0.36
173 0.32
174 0.28
175 0.29
176 0.32
177 0.29
178 0.28
179 0.26
180 0.22
181 0.2
182 0.23
183 0.22
184 0.18
185 0.16
186 0.17
187 0.17
188 0.16
189 0.13
190 0.1
191 0.12
192 0.12
193 0.12
194 0.11
195 0.11
196 0.11
197 0.12
198 0.11
199 0.1
200 0.12
201 0.12
202 0.13
203 0.12
204 0.13
205 0.18
206 0.23
207 0.28
208 0.32
209 0.34
210 0.4
211 0.5
212 0.57
213 0.61
214 0.65
215 0.69
216 0.68
217 0.7
218 0.65
219 0.59
220 0.57
221 0.58
222 0.58
223 0.58
224 0.54
225 0.54
226 0.54
227 0.52
228 0.52
229 0.46
230 0.4
231 0.34
232 0.37
233 0.37
234 0.43
235 0.48
236 0.47
237 0.46
238 0.44
239 0.48
240 0.44
241 0.46
242 0.47
243 0.48
244 0.47
245 0.51
246 0.52
247 0.45
248 0.46
249 0.44
250 0.39
251 0.34
252 0.37
253 0.34
254 0.33
255 0.33
256 0.33
257 0.32
258 0.29
259 0.26
260 0.19
261 0.21
262 0.2
263 0.21
264 0.26
265 0.28
266 0.29
267 0.33
268 0.35
269 0.34
270 0.4
271 0.45
272 0.43
273 0.4
274 0.38
275 0.39
276 0.37
277 0.34
278 0.27
279 0.21
280 0.21
281 0.2
282 0.19
283 0.14
284 0.16
285 0.18
286 0.2
287 0.18
288 0.15
289 0.16
290 0.19
291 0.23
292 0.28
293 0.35
294 0.44
295 0.54
296 0.6
297 0.66
298 0.67
299 0.69
300 0.64
301 0.58
302 0.55
303 0.53
304 0.5
305 0.45
306 0.42
307 0.36
308 0.42
309 0.44
310 0.4
311 0.33
312 0.33
313 0.38
314 0.44
315 0.52
316 0.52
317 0.56
318 0.61
319 0.69
320 0.73
321 0.77
322 0.76
323 0.79