Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Z1HWU5

Protein Details
Accession A0A4Z1HWU5   
Localization Confidence Low
Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
93-118RYPVSRTRNVQRKGEKREKTHPLKILHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16, cyto_nucl 11.333, cyto_mito 5.666, mito 5.5, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MTDYHVAVQDREGEGDALYLTCWQDLGSGKSARDFNWQNAIANVTSQDRQGSDKVSRFAYEHGSVCEAFERVSGEEYKVDESMRKQDWEAVNRYPVSRTRNVQRKGEKREKTHPLKILTVKDDSNIRSWIG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.14
3 0.13
4 0.08
5 0.07
6 0.08
7 0.07
8 0.07
9 0.07
10 0.06
11 0.09
12 0.11
13 0.15
14 0.19
15 0.21
16 0.21
17 0.26
18 0.27
19 0.25
20 0.32
21 0.31
22 0.28
23 0.34
24 0.35
25 0.31
26 0.31
27 0.31
28 0.23
29 0.2
30 0.18
31 0.12
32 0.12
33 0.11
34 0.11
35 0.1
36 0.13
37 0.13
38 0.16
39 0.18
40 0.21
41 0.22
42 0.22
43 0.22
44 0.21
45 0.21
46 0.22
47 0.2
48 0.17
49 0.16
50 0.17
51 0.16
52 0.15
53 0.14
54 0.1
55 0.07
56 0.07
57 0.07
58 0.06
59 0.08
60 0.09
61 0.09
62 0.1
63 0.1
64 0.11
65 0.11
66 0.1
67 0.11
68 0.12
69 0.18
70 0.19
71 0.2
72 0.19
73 0.25
74 0.3
75 0.33
76 0.35
77 0.32
78 0.34
79 0.34
80 0.34
81 0.31
82 0.31
83 0.32
84 0.34
85 0.37
86 0.43
87 0.52
88 0.56
89 0.62
90 0.67
91 0.71
92 0.75
93 0.8
94 0.79
95 0.76
96 0.81
97 0.83
98 0.81
99 0.8
100 0.77
101 0.71
102 0.71
103 0.7
104 0.67
105 0.6
106 0.55
107 0.47
108 0.43
109 0.44
110 0.38
111 0.36