Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Z1IU58

Protein Details
Accession A0A4Z1IU58   
Localization Confidence Medium
Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
133-170VAKEDRKKFVAQRRQERRRWRLRLRLRRKAIAQKAKAIHydrophilic
NLS Segment(s)
PositionSequence
136-170EDRKKFVAQRRQERRRWRLRLRLRRKAIAQKAKAI
Subcellular Location(s) nucl 12, cyto 6.5, cyto_mito 6.5, mito 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001841  Znf_RING  
IPR013083  Znf_RING/FYVE/PHD  
Pfam View protein in Pfam  
PF13920  zf-C3HC4_3  
PROSITE View protein in PROSITE  
PS50089  ZF_RING_2  
Amino Acid Sequences MKGGAPLKSLPLLDEIPRLSKHDECVVCCGPNYMPVATMPCGHRHTCLTCIIRWTQSEEGAPPNGCPYCRAKIARLKLFMPYPRFRVEESQTKSKYSLAKPFAETEMGYEEMEKRQEEVLEVVNLVGPWIWRVAKEDRKKFVAQRRQERRRWRLRLRLRRKAIAQKAKAI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.22
3 0.24
4 0.25
5 0.28
6 0.28
7 0.28
8 0.29
9 0.34
10 0.35
11 0.33
12 0.39
13 0.38
14 0.35
15 0.33
16 0.31
17 0.23
18 0.24
19 0.24
20 0.17
21 0.15
22 0.15
23 0.18
24 0.17
25 0.21
26 0.18
27 0.21
28 0.24
29 0.24
30 0.26
31 0.26
32 0.28
33 0.27
34 0.34
35 0.31
36 0.28
37 0.31
38 0.31
39 0.3
40 0.28
41 0.31
42 0.25
43 0.24
44 0.23
45 0.21
46 0.21
47 0.21
48 0.2
49 0.15
50 0.17
51 0.16
52 0.15
53 0.16
54 0.18
55 0.19
56 0.25
57 0.27
58 0.29
59 0.36
60 0.44
61 0.47
62 0.46
63 0.43
64 0.4
65 0.42
66 0.41
67 0.39
68 0.34
69 0.31
70 0.31
71 0.32
72 0.3
73 0.31
74 0.31
75 0.34
76 0.36
77 0.42
78 0.4
79 0.4
80 0.4
81 0.38
82 0.4
83 0.34
84 0.37
85 0.33
86 0.35
87 0.35
88 0.36
89 0.34
90 0.29
91 0.25
92 0.17
93 0.16
94 0.14
95 0.12
96 0.11
97 0.11
98 0.12
99 0.14
100 0.13
101 0.12
102 0.12
103 0.12
104 0.12
105 0.13
106 0.13
107 0.12
108 0.12
109 0.1
110 0.1
111 0.09
112 0.08
113 0.07
114 0.05
115 0.05
116 0.07
117 0.08
118 0.08
119 0.13
120 0.22
121 0.31
122 0.41
123 0.49
124 0.53
125 0.58
126 0.62
127 0.67
128 0.68
129 0.69
130 0.69
131 0.72
132 0.78
133 0.82
134 0.86
135 0.89
136 0.89
137 0.89
138 0.9
139 0.89
140 0.89
141 0.9
142 0.93
143 0.93
144 0.93
145 0.9
146 0.89
147 0.87
148 0.87
149 0.87
150 0.86