Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A5DUK2

Protein Details
Accession A5DUK2    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
267-287KQEIKEEEKKKQVKKVSNPKLBasic
NLS Segment(s)
PositionSequence
264-285RKIKQEIKEEEKKKQVKKVSNP
Subcellular Location(s) mito 12.5, plas 10, cyto_mito 7.5, E.R. 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR018811  Mrx11  
Gene Ontology GO:0016020  C:membrane  
KEGG lel:LELG_01038  -  
Pfam View protein in Pfam  
PF10306  FLILHELTA  
Amino Acid Sequences MIKTLPIKKLRVEMFGANFSRSQVLTSLHYSLMKPRTFHSSAITYKLFGKSKKPTTKPVEQVSETKLSKSKPEPISSASPSASSSSPSSSASSSTTLKSVSNDLFLKRDIPPAERPSGPTEQDFKTHPILKRIPKFLRNYASQFIHAPYSHLVAFLVLHELTAIIPLFGIWYYLHNHPGFIPMDLPQWALTKGASVMDKVLERMDWHIDSSQKISVIMEGAYAYTIVKFLLPVRAIVSLAGMPFFAKWFVVPIANLPKNLREMRKIKQEIKEEEKKKQVKKVSNPKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.48
3 0.46
4 0.39
5 0.36
6 0.33
7 0.31
8 0.25
9 0.22
10 0.16
11 0.18
12 0.19
13 0.22
14 0.23
15 0.22
16 0.24
17 0.23
18 0.29
19 0.34
20 0.33
21 0.31
22 0.31
23 0.38
24 0.39
25 0.4
26 0.37
27 0.36
28 0.36
29 0.41
30 0.4
31 0.32
32 0.34
33 0.39
34 0.39
35 0.34
36 0.4
37 0.43
38 0.53
39 0.62
40 0.63
41 0.67
42 0.7
43 0.77
44 0.77
45 0.75
46 0.72
47 0.65
48 0.64
49 0.58
50 0.58
51 0.49
52 0.43
53 0.39
54 0.32
55 0.36
56 0.37
57 0.42
58 0.4
59 0.43
60 0.44
61 0.45
62 0.5
63 0.46
64 0.44
65 0.35
66 0.3
67 0.27
68 0.26
69 0.21
70 0.17
71 0.15
72 0.14
73 0.15
74 0.16
75 0.16
76 0.14
77 0.15
78 0.15
79 0.16
80 0.16
81 0.15
82 0.15
83 0.15
84 0.15
85 0.15
86 0.17
87 0.14
88 0.17
89 0.18
90 0.19
91 0.19
92 0.19
93 0.2
94 0.18
95 0.22
96 0.19
97 0.21
98 0.27
99 0.29
100 0.32
101 0.31
102 0.32
103 0.32
104 0.34
105 0.31
106 0.27
107 0.27
108 0.24
109 0.26
110 0.25
111 0.23
112 0.25
113 0.29
114 0.29
115 0.32
116 0.37
117 0.43
118 0.47
119 0.53
120 0.53
121 0.54
122 0.57
123 0.56
124 0.54
125 0.5
126 0.48
127 0.44
128 0.4
129 0.34
130 0.31
131 0.25
132 0.22
133 0.18
134 0.16
135 0.12
136 0.12
137 0.11
138 0.1
139 0.09
140 0.07
141 0.07
142 0.06
143 0.07
144 0.05
145 0.05
146 0.05
147 0.05
148 0.04
149 0.05
150 0.05
151 0.03
152 0.03
153 0.03
154 0.04
155 0.03
156 0.05
157 0.04
158 0.06
159 0.09
160 0.1
161 0.15
162 0.15
163 0.16
164 0.15
165 0.19
166 0.18
167 0.15
168 0.15
169 0.11
170 0.12
171 0.13
172 0.13
173 0.1
174 0.11
175 0.11
176 0.1
177 0.09
178 0.08
179 0.08
180 0.1
181 0.09
182 0.09
183 0.09
184 0.1
185 0.11
186 0.11
187 0.11
188 0.09
189 0.09
190 0.11
191 0.14
192 0.13
193 0.14
194 0.16
195 0.17
196 0.18
197 0.2
198 0.2
199 0.16
200 0.16
201 0.15
202 0.13
203 0.12
204 0.1
205 0.08
206 0.07
207 0.06
208 0.06
209 0.06
210 0.05
211 0.05
212 0.05
213 0.04
214 0.04
215 0.05
216 0.07
217 0.13
218 0.13
219 0.14
220 0.15
221 0.16
222 0.16
223 0.16
224 0.15
225 0.1
226 0.1
227 0.09
228 0.08
229 0.07
230 0.07
231 0.08
232 0.07
233 0.06
234 0.06
235 0.09
236 0.11
237 0.12
238 0.12
239 0.17
240 0.27
241 0.3
242 0.32
243 0.32
244 0.33
245 0.39
246 0.45
247 0.44
248 0.43
249 0.47
250 0.53
251 0.62
252 0.68
253 0.69
254 0.71
255 0.75
256 0.74
257 0.78
258 0.8
259 0.74
260 0.75
261 0.77
262 0.78
263 0.76
264 0.76
265 0.76
266 0.76
267 0.82